KEGG   Oryctolagus cuniculus (rabbit): 100356651
Entry
100356651         CDS       T03373                                 
Symbol
TNFSF12
Name
(RefSeq) tumor necrosis factor (ligand) superfamily, member 12
  KO
K05474  tumor necrosis factor ligand superfamily member 12
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100356651 (TNFSF12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100356651 (TNFSF12)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Tumor necrosis fators
   100356651 (TNFSF12)
SSDB
Motif
Pfam: TNF C1q DUF5539
Other DBs
NCBI-GeneID: 100356651
NCBI-ProteinID: XP_008269001
LinkDB
Position
19:complement(11619181..11630775)
AA seq 250 aa
MATRRSQRRXGRRGELGTALLAPLVLGLGLALACIDLLLAVVSLGSRASLSAQQASSQGK
LVAKEEPEPPELNPQTEESQDPLPFLNGLVRPRRSAPKGRKPRARKAIAAHYEVHPRPGQ
DGAQAGVDGTVSGWEEAKINSSNPLRYDRQIGKFIVTRAGLYYLYCQVHFDEGKAVYLKL
DLLVDEVLALRCLEEFSATAASSLGPQLRLCQVSGLLPLRPGSSLRIRTLPWAHLKAAPF
LTYFGLFQVH
NT seq 753 nt   +upstreamnt  +downstreamnt
atggccacccgtcggagccagaggcggnaggggcgccggggggagctgggcaccgccctg
ctggccccgctcgtgctgggcctgggcctggctctggcctgcattgacctcctgctggcc
gtggtcagcctggggagccgggcatcgctgtccgcccagcaggcgtcttcccaggggaag
ctggtggcaaaggaggagccggagcccccggagctgaatccccagacagaggaaagccag
gatcctctgcctttcctgaacggactagttcggcctcgcagaagtgcacccaaaggccgg
aagccccgggctcgcaaagccattgccgctcactatgaagtccaccctcgaccaggacag
gacggagcacaggcaggtgtggatggcacggtgagtggctgggaggaagccaaaatcaac
agctccaaccccctgcgctatgaccgccagatcgggaaatttatagtcacccgggcaggg
ctgtactacctgtactgtcaggtgcactttgacgaggggaaggccgtctacctgaagctg
gacttgttggtggacgaggtgctggccctgcgctgcctggaggagttctcggccactgca
gccagttccctcgggccccagctgcgtctctgccaggtgtctgggctgttgcccctgcgg
ccagggtcctccttgcggatccgcaccctcccctgggcccatctcaaggcggcgcccttc
ctcacctactttggactcttccaagttcactga

DBGET integrated database retrieval system