KEGG   Oryctolagus cuniculus (rabbit): 100356696
Entry
100356696         CDS       T03373                                 
Symbol
ITCH
Name
(RefSeq) itchy E3 ubiquitin protein ligase
  KO
K05632  E3 ubiquitin-protein ligase Itchy [EC:2.3.2.26]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
ocu04144  Endocytosis
ocu04668  TNF signaling pathway
ocu04932  Non-alcoholic fatty liver disease
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100356696 (ITCH)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100356696 (ITCH)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100356696 (ITCH)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100356696 (ITCH)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100356696 (ITCH)
   04121 Ubiquitin system [BR:ocu04121]
    100356696 (ITCH)
Enzymes [BR:ocu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     100356696 (ITCH)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    100356696 (ITCH)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  HECT type E3
   100356696 (ITCH)
SSDB
Motif
Pfam: HECT WW C2
Other DBs
NCBI-GeneID: 100356696
NCBI-ProteinID: XP_008254311
Ensembl: ENSOCUG00000015354
UniProt: G1T9A1
LinkDB
Position
4:complement(5212181..5339477)
AA seq 864 aa
MSDSGSQFGSMGSLTMKSQLQITVISAKLKENKKNWFGPSPYVEVTVDGQSKKTEKCNNT
NSPKWKQPLTVIVTPVSKLHFRVWSHQTLKSDVLLGTAALDIYETLKSNNMKLEEVVVTL
QLVGDKEPTETIGDLSVCLDGLQLDSEIVTNGETTCSESASQNDDGSRPKDETRVNTNGS
DDPEDTGSSENRRVSGNNSPSLSNGGFKPSRPPRPSRPPPPTPRRPASVNGSPPATSESD
GSSTSSLPPTNTNINTSTSEGATSGLIIPLTISGGSGPRPLNTVTQAPLPPGWEQRVDQH
GRVYYVDHVEKRTTWDRPEPLPPGWERRVDNMGRIYYVDHFTRTTTWQRPTLESVRNYEQ
WQLQRSQLQGAMQQFNQRFIYGNQDLFATSQNKEFDPLGPLPPGWEKRTDSNGRVYFVNH
NTRITQWEDPRSQGQLNEKPLPEGWEMRFTVDGIPYFVDHNRRTTTYIDPRTGKSALDNG
PQIAYVRDFKAKVQYFRFWCQQLAMPQHIKITVTRKTLFEDSFQQIMSFSPQDLRRRLWV
IFPGEEGLDYGGVAREWFFLLSHEVLNPMYCLFEYAGKDNYCLQINPASYINPDHLKYFR
FIGRFIAMALFHGKFIDTGFSLPFYKRILNKPVGLKDLESIDPEFYNSLIWVKENNIEEC
GLEMYFSVDKEILGEIKSHDLKPNGGNILVTEENKEEYIRMVAEWRLSRGVEEQTQAFFE
GFNEILPQQYLQYFDAKELEVLLCGMQEIDLNDWQRHAIYRHYTRTSKQIMWFWQFVKEI
DNEKRMRLLQFVTGTCRLPVGGFADLMGSNGPQKFCIEKVGKENWLPRSHTCFNRLDLPP
YKSYEQLKEKLLFAIEETEGFGQE
NT seq 2595 nt   +upstreamnt  +downstreamnt
atgtctgacagtggatcacaatttggttcaatgggtagcctgaccatgaaatcacaactt
cagatcactgtcatctcagccaaacttaaggaaaataaaaagaattggtttggaccaagt
ccttatgtagaagtcacagttgatgggcagtcaaagaagacagaaaaatgcaataataca
aacagtcccaaatggaagcaaccccttacagttattgttacccctgtgagtaaattacat
tttcgtgtgtggagtcaccagacattgaaatctgatgttttattgggaactgctgcatta
gatatttatgaaaccttaaagtcaaacaatatgaaacttgaggaggtggttgtgactttg
cagcttgtaggtgacaaagagccaacagagacaatcggagacttatcagtttgtctggat
gggctgcaattagattctgagattgttactaatggtgaaactacatgttcagaaagtgct
tcacagaatgatgatggctccagacccaaggatgaaacaagagtgaatacaaatggatca
gatgaccctgaggatacagggtccagtgaaaataggagggtcagtgggaataattctcca
tcactctcaaatggcggttttaagccttctaggccaccaagaccttcccgaccacctcca
cccaccccacgtagaccagcatctgtcaatggttctccacctgctacttctgaaagtgat
ggatcaagtacaagctctctgccacccacaaatacaaatataaatacaagtacatctgaa
ggagcaacatctggattaataattcctcttaccatatctggaggctcaggccctaggcca
ttaaatactgtaactcaagctcccctaccacctgggtgggagcagagagtagaccaacat
gggcgagtttactatgtagatcatgtcgaaaaaagaacaacgtgggatagaccagaacct
ctacctcctggctgggaacggcgggttgacaacatgggacgtatttattacgttgaccat
ttcacaagaacaacaacatggcagaggccaacattggaatctgtccggaactatgaacag
tggcagctacaacgtagtcaacttcaaggagcaatgcagcagtttaaccagagattcatc
tatgggaatcaagatttgtttgccacatcacaaaataaagaatttgatccccttggtcct
ttgccacctggttgggagaagagaactgacagcaatggcagagtgtattttgtcaaccat
aacactcgaattacacaatgggaagacccccgaagtcaaggtcaattaaatgaaaagccc
ttacctgaaggttgggaaatgagattcacagtggatggaattccatattttgtggaccat
aatagaagaacaactacctatatagatcctcgcacaggaaaatctgccctagacaatggg
ccacagatagcctatgttcgggacttcaaagcaaaggttcagtatttccggttctggtgt
cagcaactggccatgccacagcacataaagattacagtgaccagaaaaacgttgtttgag
gattcctttcaacagataatgagcttcagtccccaagatctgcgaagacgtttgtgggtg
atttttccaggagaagaaggtttagattatggaggtgtagcaagagaatggttctttctt
ttgtcacatgaagtgttgaacccaatgtattgcctgtttgaatatgcagggaaggataac
tactgcttgcagataaaccctgcttcttacatcaatccagatcacctgaaatattttcgc
tttattgggaggtttattgccatggctctatttcatgggaaattcatagacacaggcttc
tctttaccattttataaacgtatcttgaacaaaccagttggacttaaggatttagaatct
attgatccagaattttataattccctcatctgggttaaagaaaacaatattgaggaatgt
ggtttggaaatgtacttttccgttgataaagaaattctaggtgaaattaagagtcatgat
ctgaaaccaaatggtggcaatattcttgtaacagaagaaaataaagaggaatatatcaga
atggtagctgaatggaggttgtctcgaggtgttgaagaacagacacaagctttctttgag
ggctttaatgaaattcttccccagcagtatttgcaatactttgatgcaaaggaattagag
gttcttttatgtggaatgcaagagattgatttgaatgactggcaaagacatgccatttac
cgtcattacactcggacaagcaaacagatcatgtggttctggcagtttgttaaagaaata
gataatgagaagagaatgcgacttctgcagtttgttactggaacctgccgattgccagta
ggaggatttgctgacctcatggggagcaatggaccacagaaattctgcattgaaaaagtt
ggaaaggagaattggttacccagaagtcatacttgttttaaccgcctggacctgccaccc
tacaagagctatgagcaactgaaggaaaagctgttgtttgccattgaagaaacagaagga
ttcgggcaagagtaa

DBGET integrated database retrieval system