KEGG   Oryctolagus cuniculus (rabbit): 100357447
Entry
100357447         CDS       T03373                                 
Symbol
SAE1
Name
(RefSeq) SUMO1 activating enzyme subunit 1
  KO
K10684  ubiquitin-like 1-activating enzyme E1 A [EC:6.2.1.45]
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100357447 (SAE1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    100357447 (SAE1)
Enzymes [BR:ocu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.45  E1 ubiquitin-activating enzyme
     100357447 (SAE1)
Ubiquitin system [BR:ocu04121]
 Ubiquitin-activating enzymes (E1)
  UBL-activating enzymes
   100357447 (SAE1)
SSDB
Motif
Pfam: ThiF
Other DBs
NCBI-GeneID: 100357447
NCBI-ProteinID: XP_008249028
Ensembl: ENSOCUG00000024320
LinkDB
Position
Un
AA seq 382 aa
MRRHSPGVRPAAVGGARDRLPVGVSGTGAEAERGRAMVEKEEAGGGISEEEAAQYDRQIR
LWGLEAQKRLRASRVLLVGMKGLGAEIAKNLILAGVKGLTMLDHEQVSPEDPGAQFLIRT
GSVGRNRAEASLERAQNLNPMVDVKVDTEEIEKKPESFFTQFDAVCLTCCSRDVIVKVDQ
ICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAKVSQGVEDGPDTKRVKLDSSET
TMVKKKVVFCPIKEALEVDWSSDKAKATLKRTTSDYFLLQVLLKFRTDKGRDPGSATRGE
DAELLLQIRNDVLDSLGVSADLLPDDFVRYCFSEMAPVCAVVGGILAQEIVKALSQRDPP
HNNFFFFDGMKGNGIVECLGPK
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgcgtagacacagcccgggcgttcggccggcggcagttggcggcgcgcgggaccggctg
cctgttggcgtgagcgggaccggagcggaggcagagcgaggccgcgccatggtggagaag
gaggaggcaggtggcggcatcagcgaggaggaggcggcgcagtatgaccggcagatccgc
ctgtggggactggaggcccagaaacggctgcgggcctcccgggtgcttcttgtcggcatg
aaaggacttggggctgaaattgccaagaatctcatcctggcaggagtgaaaggactgacc
atgctggatcacgaacaggtatctccagaggatcctggagcacagttcctgatccggacc
gggtctgttggtcggaaccgggccgaagcctccttggagcgtgcccagaacctcaacccc
atggtggacgtgaaggtggacactgaggagatagagaagaagccggagtcgttcttcacg
cagtttgatgctgtgtgcctgacctgctgctccagggatgtcatagtcaaagttgaccag
atctgtcacaaaaacagcatcaagttctttacaggagatgtttttggctaccatggatac
acatttgcgaatcttggggagcatgagtttgtggaggagaaaaccaaagttgccaaagtc
agccaaggagtggaagatggacctgataccaagagagtaaaacttgattcatctgagaca
actatggtaaaaaagaaggtggtcttctgccccattaaggaagcactggaggtagactgg
agcagtgacaaagccaaggccactctgaagcgcacaacttctgactactttctcctgcaa
gtgctcctgaaattccgcacggataaaggaagagaccctggctctgccacgcgcggggaa
gatgctgagctgttgctgcagatccgaaacgacgtgctggactcgctgggtgtcagtgct
gacctgctgcccgacgacttcgtcaggtactgcttctccgagatggcccctgtgtgcgcg
gtggttggcgggatcttggcacaggaaattgtgaaggccctgtcgcagagagaccctcct
cacaacaacttcttctttttcgatggcatgaaggggaatggcatcgtcgagtgccttggc
cccaagtga

DBGET integrated database retrieval system