KEGG   Oryctolagus cuniculus (rabbit): 100357864
Entry
100357864         CDS       T03373                                 
Symbol
SH3KBP1
Name
(RefSeq) SH3 domain containing kinase binding protein 1
  KO
K12470  SH3 domain-containing kinase-binding protein 1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100357864 (SH3KBP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ocu04131]
    100357864 (SH3KBP1)
Membrane trafficking [BR:ocu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    100357864 (SH3KBP1)
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    100357864 (SH3KBP1)
SSDB
Motif
Pfam: SH3_9 SH3_2 SH3_1 Tmemb_cc2 DUF1664
Other DBs
NCBI-GeneID: 100357864
NCBI-ProteinID: XP_008270637
Ensembl: ENSOCUG00000006268
LinkDB
Position
X:complement(5233283..5560879)
AA seq 672 aa
MELPAAQAPSAVDVSEIEIKKDMKKDPLSSKAPEKPMQEVSSGNSLLSSETILRTNKRGE
RRRRRCQVAFSYLPQNDDELELKVGDIIEVVGEVEEGWWEGVLNGKTGMFPSNFIKELSG
ESDELGISQDEQLSKSRPEGLPPASLLPFPAHGAKGKTTFEGTILYRAAPGKTEGHRRYY
SLRETTGSESDGGDSSSTKSEGANGTVATAAIQPKKVKGVGFGDIFKDKPIKLRPRSIEV
ENDFLPVEKTIGKKLPPTAATPDSSKTEMDSRTKTKDYCKVIFPYEAQNDDELTIKEGDI
VTLINKDCIDVGWWEGELNGRRGVFPDNFVKLLPPDFDKEGNRPKKPPPPSAPVIKAGAG
TTERKHEIKKIPPERPETLPNRTEEKDRPEREQKLDLQKPSVPAIPPKKPRPPKTNSLSR
PGALPPRRPERPVGPLTHTRGDGAKIDLVGSALSGILDKELSDRSNDIDLEGFDSVVSST
EKLSHPTTSRPKATGRRPPSQSLTSSSLSSPDIFDSPSPEEDKEEHISLAHRGVDASKKT
SKTVAISQVSDSKASLPPKPGTMAAGGGGPAPLSSAAPSALSSSLGTAGHRANSPSLFGM
EGKPKMEPAGSGQAAVEELRTQVRELRSIIETMKDQQKREIKQLLSELDEEKKIRLRLEM
EVNDIKKALQSK
NT seq 2019 nt   +upstreamnt  +downstreamnt
atggaacttccagcagcccaagccccgagtgccgtagacgtgtctgagatcgaaataaag
aaagacatgaagaaagaccctctctccagcaaagctccggaaaagcccatgcaggaagtg
tccagtggaaactctttgctgtcttctgaaaccattttaagaactaataagagaggcgag
cgacggagacgccggtgtcaggtggcgttcagctacctgccgcagaatgatgatgagctt
gagctgaaagtcggagacatcatagaggtggtaggagaggtggaagaaggatggtgggaa
ggtgttctcaatgggaagactggaatgtttccttccaacttcatcaaggagctgtcgggc
gagtcggatgagcttggcatctcccaggatgagcaactgtccaagtcaaggcctgaaggt
ctccctccagcttctctgctgccctttccagctcacggagcaaaaggaaagactaccttt
gaagggacaattctgtaccgagctgcgccgggaaagacggagggccacagacgctattac
agtttaagggaaacgacaggctccgagagtgatgggggtgactcgagcagtaccaaatcg
gaaggtgccaatgggacggtagcaactgcagccatccaacccaagaaagttaagggagtg
ggctttggagatattttcaaagacaagccaatcaaactaagaccaaggtcaattgaagta
gaaaacgacttcctgccagtggaaaagactatcgggaagaagttacctccaactgcagca
actccagactcctcgaaaactgaaatggacagcaggacaaagaccaaggattactgcaaa
gtaatatttccatatgaggcgcagaatgatgatgaattgacaatcaaagaaggggatata
gtcacgctcatcaacaaggactgcatcgacgtaggctggtgggaaggagagctcaacggc
agacgcggagtgttccctgataactttgtgaaactgcttccaccggactttgacaaggaa
gggaatagacccaagaagccaccgcctccatccgctcctgtcatcaaagcaggggcaggt
accaccgagagaaaacatgaaattaaaaagatacctcctgaaagaccagaaacacttcca
aacagaacagaagaaaaagacagaccagagagggagcaaaaactggacttacagaagccc
tccgttcctgccatcccaccaaaaaagcctcggccacctaagaccaattctctgagcaga
cctggcgcactgcccccgagaaggcccgagcgaccagtgggcccactgacacacaccagg
ggtgacggtgcaaagattgatctggtgggcagtgcgctctccggcatcctggacaaggag
ctctcagaccgcagcaatgatattgacctagaaggttttgactccgtggtgtcatcgact
gagaaactcagccacccaaccacaagcagaccaaaagcgacggggaggcggcctccgtcc
cagtctctcacatcttcctccctttcaagccctgatatcttcgactccccaagtcccgaa
gaagataaagaggaacacatttcacttgcacacagaggagtggatgcgtcaaagaaaact
tccaagactgttgccatatcccaagtgtccgacagcaaagcgtccctgccgcccaagcca
gggaccatggcagcaggaggtggagggccagcccctctgtcctcggcggcaccctctgcc
ctgtcgtcctctttgggaacagctggacacagagccaactccccatctctgttcggcatg
gaaggaaaaccaaagatggagcccgcgggcagcggccaggccgccgtggaggagctgagg
acacaggtccgcgagctgaggagcatcattgagaccatgaaggaccagcagaaacgagag
attaagcagttattgtcggagctggacgaagagaagaaaatccggcttcggttggagatg
gaagtgaatgacataaagaaagctcttcaatcaaaatga

DBGET integrated database retrieval system