KEGG   Oryctolagus cuniculus (rabbit): 100358260
Entry
100358260         CDS       T03373                                 
Symbol
TNFRSF11A
Name
(RefSeq) TNF receptor superfamily member 11a
  KO
K05147  tumor necrosis factor receptor superfamily member 11A
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04064  NF-kappa B signaling pathway
ocu04380  Osteoclast differentiation
ocu04917  Prolactin signaling pathway
ocu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100358260 (TNFRSF11A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100358260 (TNFRSF11A)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    100358260 (TNFRSF11A)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100358260 (TNFRSF11A)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    100358260 (TNFRSF11A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ocu04050]
    100358260 (TNFRSF11A)
   04090 CD molecules [BR:ocu04090]
    100358260 (TNFRSF11A)
Cytokine receptors [BR:ocu04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   100358260 (TNFRSF11A)
CD molecules [BR:ocu04090]
 Proteins
  100358260 (TNFRSF11A)
SSDB
Motif
Pfam: RANK_CRD_2 TNFR_c6 Chordopox_A13L
Other DBs
NCBI-GeneID: 100358260
NCBI-ProteinID: XP_008259656
Ensembl: ENSOCUG00000005308
LinkDB
Position
9:102636620..102697226
AA seq 611 aa
MAPRARRRRPLPALLALCALLAPLQVSLQVAPPCASDRHYEHAGRCCRKCEPGKYLSSKC
TTTTDSVCLSCGPDEYLDTWNEEDKCLLHKVCDTGKALVAVDPGNSTAPRRCACTAGYHW
SQDCECCRRNAECAPGFGAQHPLQLNKDTVCKPCQAGYFSDTFSAMDRCKPWTNCTILGK
IEERHGTEKSDVVCSSSLPSRKPPNEPEVYLPSLIILLLFISVAIVAAVIFVVYYRKQGK
ALTANLWHWVNEACGRLSGNKEASGDGCISTHTLAAAPREACEGVLLLTVEEKTFPEDMC
YPDGAAACAGSGPCTQGARAPTLSLVSELDGEGDSFRQIPTEDEYVDRPLPLARPGGTAS
PPFPEPLEVGENDSLSQCFTGTESALDSDSCHLPEPPGGADWTPLTSEKYLQTEVEGGAC
SSLAHGCQACASPPGEDREPLTDSPKHGPLPQCAYGMGLPAEEGAARANSAEQPEDWADV
RLPGSTRGGAASGSSPSDQPPASGNVTGNSNSTFISSGQVMNFKGDIIVVYVSQTSQEGA
AGPGGAAAEPVGRPVQEETLSRRDSFAGNGPRFPDACAGPEAWPGAGMQEQGAPGPEKAS
RPVQEQGGAEA
NT seq 1836 nt   +upstreamnt  +downstreamnt
atggccccgcgcgcccggcggcgccgcccgctgcccgcgctgctggcgctgtgcgcgctg
ctcgccccgctgcaggtgagtctgcaggtggctcctccctgcgccagcgacaggcattac
gaacacgccgggcggtgctgccgcaagtgtgaaccaggaaagtacttgtcttctaaatgc
actactaccactgacagtgtgtgtctgtcctgtggcccggatgaatacctggacacctgg
aatgaagaagataaatgcttgctgcataaagtttgtgacactggcaaggccctggtggcc
gtggaccccggcaacagcacggccccgcgacgctgcgcctgcacggccgggtaccactgg
agccaggattgcgagtgctgccgccgcaacgccgagtgcgccccgggcttcggcgcccag
caccccttgcagctcaacaaggacacggtgtgtaagccttgccaagccggctacttctca
gacaccttttctgccatggacagatgcaaaccctggaccaactgtaccatccttggaaag
atagaagaacgtcacgggacggaaaaatcagatgtggtttgcagttcctctctgccatct
agaaagccaccgaatgaacctgaggtttacttgcccagtctaattatcctgcttctcttc
atatccgtggcgatagttgctgctgtcatctttgtagtttactataggaaacaagggaag
gcactaacagctaatttgtggcactgggtcaatgaggcttgtggccgcctaagcggaaat
aaggaggcctccggcgacggctgcatcagcacgcacacgttggccgccgctccgcgcgag
gcgtgtgaaggagtcctgctgctgaccgtagaggagaagacgtttccagaagacatgtgc
tacccggacggcgcggctgcctgcgcgggaagcgggccctgcacacagggcgcgcgtgct
cccacgctgtccttggtcagcgagctggacggtgaaggggactccttccggcagatcccc
acggaagacgagtacgtggacaggcccttgcccctcgctcggcccggaggcacagcctcg
ccgcccttcccggagcccctggaggtgggggagaatgacagtctgagccagtgcttcacg
gggaccgagagcgcgctggattccgacagctgccacctgcccgagcccccaggcggggcc
gactggacgcccctgacctccgaaaagtacttgcaaacagaggtggaggggggcgcttgc
tccagcttggcccacggctgccaagcctgcgcaagcccccctggggaggaccgtgaaccc
ctcacggactccccgaaacacggacccttgccccagtgcgcctacggcatgggccttccg
gccgaagaaggagctgccagggcgaacagcgccgagcagcccgaggactgggctgacgtg
cggcttccgggctccactcggggaggcgctgcgtccggaagctcccctagcgaccagccc
cctgcttccggaaatgtgactggaaacagtaactccacgttcatttccagcgggcaagtg
atgaacttcaagggcgacatcatcgtggtctacgtcagtcagacctcgcaggagggcgcg
gcggggccggggggcgcggccgcggagcccgtgggccgcccggtgcaggaggagaccctg
agccgccgcgactccttcgcgggcaacggcccgcgcttcccggacgcgtgcgccggcccc
gaggcgtggcccggagcgggcatgcaggagcagggcgcgcccgggccggagaaggcctcg
cggcccgtgcaggagcagggcggggccgaggcctga

DBGET integrated database retrieval system