KEGG   Oryctolagus cuniculus (rabbit): 100358388
Entry
100358388         CDS       T03373                                 

Symbol
CD40LG, TNLG8B
Name
(RefSeq) CD40 ligand
  KO
K03161  tumor necrosis factor ligand superfamily member 5
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04064  NF-kappa B signaling pathway
ocu04514  Cell adhesion molecules
ocu04660  T cell receptor signaling pathway
ocu04672  Intestinal immune network for IgA production
ocu05144  Malaria
ocu05145  Toxoplasmosis
ocu05310  Asthma
ocu05320  Autoimmune thyroid disease
ocu05322  Systemic lupus erythematosus
ocu05330  Allograft rejection
ocu05340  Primary immunodeficiency
ocu05416  Viral myocarditis
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100358388 (CD40LG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100358388 (CD40LG)
   04514 Cell adhesion molecules
    100358388 (CD40LG)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100358388 (CD40LG)
   04672 Intestinal immune network for IgA production
    100358388 (CD40LG)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05144 Malaria
    100358388 (CD40LG)
   05145 Toxoplasmosis
    100358388 (CD40LG)
  09163 Immune disease
   05310 Asthma
    100358388 (CD40LG)
   05322 Systemic lupus erythematosus
    100358388 (CD40LG)
   05320 Autoimmune thyroid disease
    100358388 (CD40LG)
   05330 Allograft rejection
    100358388 (CD40LG)
   05340 Primary immunodeficiency
    100358388 (CD40LG)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100358388 (CD40LG)
   05416 Viral myocarditis
    100358388 (CD40LG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    100358388 (CD40LG)
   04090 CD molecules [BR:ocu04090]
    100358388 (CD40LG)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Tumor necrosis fators
   100358388 (CD40LG)
CD molecules [BR:ocu04090]
 Proteins
  100358388 (CD40LG)
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 100358388
NCBI-ProteinID: NP_001243710
Ensembl: ENSOCUG00000003911
UniProt: G1SKP7
LinkDB
Position
X
AA seq 261 aa
MIETYSQPTPRSVATGPSVSMKIFMYLLTVFLITQMIGSALFAVYLHRRLDKIEDERNLH
EDFVFMKTIQRCNKGEGSLSLLNCKEIRSQFEGFVKDIMLNKEEPKKEINFEMQKGDQDP
QIAAHLISEASSKSSSVLQWAKKGYYTMSNTLVTLENGKQLKVKRQGFYYIYAQVTFCSN
QEPSSQAPFIASLCLKSSGGSERILLRAANARSSSKTCEQQSIHLGGVFELQADASVFVN
VTDASQVNHGTGFTSFGLLKL
NT seq 786 nt   +upstreamnt  +downstreamnt
atgatcgaaacgtacagccaacctactcctcgttctgtggccactggaccatctgttagc
atgaaaatttttatgtatttacttactgtttttcttattacccagatgatagggtcagcg
ctttttgctgtatatcttcatagaaggttggacaagatagaagatgaaaggaatcttcat
gaggattttgtattcatgaaaacgatacagagatgcaacaaaggagaagggtccttatcc
ctactgaactgtaaggaaattagaagccagtttgaaggcttcgtcaaggatataatgcta
aacaaagaggagccgaagaaagaaataaattttgaaatgcaaaaaggtgatcaggatcct
caaattgcagcacatctcataagtgaggccagtagtaaatcatcatctgttctacagtgg
gctaaaaaaggatattacaccatgagcaacactttggtaactcttgaaaatggaaaacag
ctgaaagtgaaaagacaaggattctattatatctatgcccaagtcaccttctgttccaat
caggaaccttcaagtcaagctccatttatagccagcttatgcctgaagtcttctggtgga
tcagaacgaatcctactcagagcagcaaatgcccgcagttcctccaaaacttgtgagcag
caatccatccacttgggaggagtatttgaattgcaagcggatgcttcggtgtttgtgaat
gtgactgatgcaagccaagtgaaccacgggaccggtttcacatcatttggcttactcaaa
ctctga

DBGET integrated database retrieval system