KEGG   Oryctolagus cuniculus (rabbit): 100358763
Entry
100358763         CDS       T03373                                 
Symbol
IRF7
Name
(RefSeq) interferon regulatory factor 7
  KO
K09447  interferon regulatory factor 7
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05164  Influenza A
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05203  Viral carcinogenesis
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100358763 (IRF7)
   04621 NOD-like receptor signaling pathway
    100358763 (IRF7)
   04622 RIG-I-like receptor signaling pathway
    100358763 (IRF7)
   04623 Cytosolic DNA-sensing pathway
    100358763 (IRF7)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    100358763 (IRF7)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100358763 (IRF7)
   05160 Hepatitis C
    100358763 (IRF7)
   05164 Influenza A
    100358763 (IRF7)
   05162 Measles
    100358763 (IRF7)
   05168 Herpes simplex virus 1 infection
    100358763 (IRF7)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100358763 (IRF7)
   05169 Epstein-Barr virus infection
    100358763 (IRF7)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100358763 (IRF7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    100358763 (IRF7)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    100358763 (IRF7)
SSDB
Motif
Pfam: IRF-3 IRF
Other DBs
NCBI-GeneID: 100358763
NCBI-ProteinID: XP_008251920
Ensembl: ENSOCUG00000002339
UniProt: G1SHC1
LinkDB
Position
Un
AA seq 438 aa
MASAPEGRPPRVLFGEWLLQQVSSGRYEGLCWLNEARTRFRVPWKHFARRDLSEADARIF
KAWAVARGRWPPSRLEGDQLPPEAAERAGWKTNFRCALKSTRRFVMLRDNSTDPADPHKV
FELSPTPRGREDPGVEEEDALQDAPPTQGGAPTPFLAGGAAAAPCGDILLEALQSCLGEE
WGADPAPPQALGPALPVEVSPACTAEGVLSPEPPARALMTEPSPGVLDVTIMYKGRTVLQ
EVVGRPSCVFLYGPPSPAVAGAGPQQVAFPSPAELADQQQLRYTEELLRHVAPGLQLELR
GWGLWALRMGKCKVYWEVGGPLGCDRPCSPARPLARNCHTPIFDFSTFFQELAEFRARRR
KDSPRYTIYLGFGQDLSASRPKDKSLVLVKLEPWLCRAHLEGVQREGVSSLDGGSLSLCL
SSTNSLYDDIERFLMELG
NT seq 1317 nt   +upstreamnt  +downstreamnt
atggcctccgctcccgaggggcggcctccgcgcgtgctcttcggggagtggctcctgcaa
caggtcagcagcggccgctacgaggggctgtgctggctgaacgaggcccgcacgcgcttc
cgcgtgccctggaagcacttcgcgcgcagggacctgagcgaagccgacgcgcgcatcttc
aaggcctgggcggtggcccgcggtaggtggccgcccagccgcctcgaaggtgaccagctg
cccccagaagcggctgagcgcgctggctggaaaaccaacttccgctgcgcgctgaagagc
acgcgacgcttcgtgatgctgcgcgataactccacggaccccgcagacccgcacaaggtg
ttcgagctgagccccacgccgcgcgggagagaagacccaggcgtggaggaggaagatgct
ctccaagatgccccacccacacagggcggggcccccacgccattcctggccggaggagca
gcggccgccccctgcggggacatcctgctggaggctctgcagagctgcctgggggaagag
tggggggcagacccagcccctccacaggctctgggcccagcgctccctgttgaagtgtcc
ccagcgtgcacagcagagggcgttctgagcccagagcccccggcccgggccctgatgaca
gagcccagcccaggcgtcctggacgtgaccatcatgtacaaggggcgcacggtgctgcag
gaggtggtggggcgcccgagctgcgtgttcctgtacgggccccccagccccgcggtggca
ggggcagggccacagcaggtggccttccccagcccggctgagctggcggaccagcagcag
ctgcggtacacggaggagctgctgcggcacgtggcgcccgggctgcagctggagctgcgg
ggctgggggctgtgggccctgcgcatgggcaagtgcaaggtgtactgggaggtgggcggc
cccctgggctgcgaccgcccctgcagccccgcccggccgctggcgcgcaactgccacacc
cccatcttcgacttcagcaccttcttccaagagctggcagagttccgggcacggcggcgc
aaggactccccacgctacaccatctacctgggcttcgggcaggacctgtcggccagcagg
cccaaagacaagagcctggtcctggtcaagctggagccgtggctgtgccgtgcacacctg
gagggggtgcagcgggagggcgtgtcctccctggacggcggcagcctgagcctgtgcctg
tccagcaccaacagcctgtacgacgacattgagcgcttcctcatggagctggggtag

KEGG   Oryctolagus cuniculus (rabbit): 103346571
Entry
103346571         CDS       T03373                                 
Symbol
IRF3
Name
(RefSeq) interferon regulatory factor 3
  KO
K05411  interferon regulatory factor 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04623  Cytosolic DNA-sensing pathway
ocu04936  Alcoholic liver disease
ocu05133  Pertussis
ocu05135  Yersinia infection
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05163  Human cytomegalovirus infection
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05170  Human immunodeficiency virus 1 infection
ocu05171  Coronavirus disease - COVID-19
ocu05203  Viral carcinogenesis
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103346571 (IRF3)
   04621 NOD-like receptor signaling pathway
    103346571 (IRF3)
   04622 RIG-I-like receptor signaling pathway
    103346571 (IRF3)
   04623 Cytosolic DNA-sensing pathway
    103346571 (IRF3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    103346571 (IRF3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103346571 (IRF3)
   05161 Hepatitis B
    103346571 (IRF3)
   05160 Hepatitis C
    103346571 (IRF3)
   05171 Coronavirus disease - COVID-19
    103346571 (IRF3)
   05164 Influenza A
    103346571 (IRF3)
   05162 Measles
    103346571 (IRF3)
   05168 Herpes simplex virus 1 infection
    103346571 (IRF3)
   05163 Human cytomegalovirus infection
    103346571 (IRF3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103346571 (IRF3)
   05169 Epstein-Barr virus infection
    103346571 (IRF3)
   05165 Human papillomavirus infection
    103346571 (IRF3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    103346571 (IRF3)
   05133 Pertussis
    103346571 (IRF3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    103346571 (IRF3)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    103346571 (IRF3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ocu03000]
    103346571 (IRF3)
   04131 Membrane trafficking [BR:ocu04131]
    103346571 (IRF3)
Transcription factors [BR:ocu03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters interferon-regulating factors
    103346571 (IRF3)
Membrane trafficking [BR:ocu04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    103346571 (IRF3)
SSDB
Motif
Pfam: IRF-3 IRF DUF4741
Other DBs
NCBI-GeneID: 103346571
NCBI-ProteinID: XP_008251035
LinkDB
Position
Un
AA seq 435 aa
MPVAGRPKRGETGGSMGTQKPRILPWLIQQLDLGQLEGVSWVDEHRKRFRIPWKHGLRQD
AQPQDFGIFQAWAEASGAYTPGDRPDLPTWKRNFRSALNRKEVVRLAEDRSKDPHDPHKV
YEFVTSGAGDISPEVQGDSTSESQEDELEQLLGDMGLAAGPDEGPWAGAVAPECCPQLLL
SPHLDHPGPCPHPAPPENPLRQLLVPEEQWEFEVTAFYRGRQVFQQTICCPGGLRLVGPE
AAARTLPGQPVALPDPGTALSDGSVSCYVRRVLQSLEGGLALWQLGPRLCARRLGHCHTY
WAVGEELLPNSGHGPAGEVPKDQDGSVFELGPFVADLIAFMEGSGHSPRYTLWFCLGEAW
PQDQPWVKRLVMVKVVPMCLKALLDMARAGGASSLENSVDLHISNSQPLSLTSDQYKAYL
QDLMEDMDFQVTGEP
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgcctgtggccggaagaccgaaaaggggcgagacgggcgggagcatggggacgcagaag
ccgcggatcctgccctggctgatccagcagctggacctggggcagctggagggcgtgtcg
tgggtggacgagcaccggaagcgcttccggataccttggaagcacgggctgcggcaggat
gcgcagccgcaggacttcggcatcttccaggcctgggcagaggccagcggcgcctatact
cccggggataggcccgacctgccaacctggaagaggaacttccggtccgccctaaaccgg
aaggaagtggtgcgtttagctgaggaccggagcaaggaccctcacgacccgcacaaggtc
tacgagtttgtgacctcaggagctggggacatctctcccgaagttcagggggacagtacc
tctgagagccaggaagacgagctggagcagctcctgggcgacatgggcctggcggccggc
ccggacgaggggccctgggctggggctgtggcccctgagtgctgccctcagctcttgctg
agccctcacctggaccaccccggcccctgcccgcaccccgcaccccctgaaaacccactg
aggcagctgctggtgcccgaggaacagtgggagttcgaggtgaccgccttctaccggggc
cgccaggtcttccagcagaccatctgctgcccaggaggcctgcggctcgtgggcccggaa
gccgcagccaggacgctgccggggcagccggtagccctgccggaccccgggacggccctg
tctgacgggagcgtgagctgctacgtgcgacgcgtgctccagagcctggaggggggactg
gccctgtggcagctggggcctcggctctgtgcccggcggctggggcactgccacacctac
tgggccgtgggggaggagctgctccccaacagcgggcacgggcccgccggcgaggtcccc
aaggaccaggacggaagcgtgttcgagctggggcccttcgtggcagatctgatcgcgttc
atggaaggaagcggacactcacctcgctacaccctctggttctgtttgggggaggcctgg
ccccaggaccagccgtgggtcaagaggctcgtgatggtcaaggtcgtgcccatgtgcctc
aaggccctgttagacatggccagggcagggggcgcctcctccctggagaacagcgtggac
ctgcacatttccaacagccagccgctctccctcacctccgaccagtacaaggcctacctg
caggacctgatggaggacatggatttccaagtcactggggagccctga

DBGET integrated database retrieval system