KEGG   Oryctolagus cuniculus (rabbit): 100359083
Entry
100359083         CDS       T03373                                 
Symbol
TRAF3
Name
(RefSeq) TNF receptor associated factor 3
  KO
K03174  TNF receptor-associated factor 3
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04064  NF-kappa B signaling pathway
ocu04620  Toll-like receptor signaling pathway
ocu04621  NOD-like receptor signaling pathway
ocu04622  RIG-I-like receptor signaling pathway
ocu04657  IL-17 signaling pathway
ocu04668  TNF signaling pathway
ocu04936  Alcoholic liver disease
ocu05160  Hepatitis C
ocu05161  Hepatitis B
ocu05162  Measles
ocu05164  Influenza A
ocu05165  Human papillomavirus infection
ocu05167  Kaposi sarcoma-associated herpesvirus infection
ocu05168  Herpes simplex virus 1 infection
ocu05169  Epstein-Barr virus infection
ocu05171  Coronavirus disease - COVID-19
ocu05200  Pathways in cancer
ocu05203  Viral carcinogenesis
ocu05222  Small cell lung cancer
ocu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100359083 (TRAF3)
   04668 TNF signaling pathway
    100359083 (TRAF3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100359083 (TRAF3)
   04621 NOD-like receptor signaling pathway
    100359083 (TRAF3)
   04622 RIG-I-like receptor signaling pathway
    100359083 (TRAF3)
   04657 IL-17 signaling pathway
    100359083 (TRAF3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100359083 (TRAF3)
   05203 Viral carcinogenesis
    100359083 (TRAF3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100359083 (TRAF3)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100359083 (TRAF3)
   05160 Hepatitis C
    100359083 (TRAF3)
   05171 Coronavirus disease - COVID-19
    100359083 (TRAF3)
   05164 Influenza A
    100359083 (TRAF3)
   05162 Measles
    100359083 (TRAF3)
   05168 Herpes simplex virus 1 infection
    100359083 (TRAF3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100359083 (TRAF3)
   05169 Epstein-Barr virus infection
    100359083 (TRAF3)
   05165 Human papillomavirus infection
    100359083 (TRAF3)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    100359083 (TRAF3)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    100359083 (TRAF3)
SSDB
Motif
Pfam: zf-TRAF zf-C3HC4 zf-C3HC4_2 MPS2 Cast Spc29 Tropomyosin_1 ATG16 KxDL Crescentin GAS FliJ Exonuc_VII_L DUF1664 T3SSipB BLOC1_2 SPATA24
Other DBs
NCBI-GeneID: 100359083
NCBI-ProteinID: XP_002721762
Ensembl: ENSOCUG00000003672
UniProt: G1SK65
LinkDB
Position
Un
AA seq 568 aa
MESSKKMDSPGTVQANPPLKLHPDRGAGTAVFAPEQGGYKEKFVKTVEDKYKCEKCRLVL
CNPKQTECGHRFCESCMAALLSSSSPKCTACQESIVKDKVFKDNCCKREILALQICCRNE
SRGCAEQLALGHLLVHLKNDCQFEELACVRADCKEKVLRKDLRDHVEKACKYREATCSHC
KSQVPMITLQKHEDTECPCVVVSCPHKCSVLTLLRSELSAHLSECVNAPSTCSFKRYGCV
FQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEI
EIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNR
VTELESVDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIW
KIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRG
EYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFRKPTGEMNIASGCPVFVAQ
TVLENGTYIKDDTIFIKVIVDTSDLPDP
NT seq 1707 nt   +upstreamnt  +downstreamnt
atggagtcaagtaaaaagatggactcccctggcacagtgcaggcaaacccaccgctgaag
ctgcaccctgaccggggcgctgggacagctgttttcgcccctgagcagggaggctacaag
gagaagtttgtgaagactgtggaggacaagtacaagtgtgagaagtgccgcctggtgctg
tgcaacccgaagcagaccgagtgtgggcaccggttctgtgagagctgcatggctgccctg
ttgagctcctcaagtccgaaatgtaccgcgtgtcaagaaagcattgtgaaagacaaggtg
ttcaaggacaactgctgcaagagagagattctggcccttcagatctgctgtcggaacgag
agcagaggctgtgcggagcagttggcactggggcatctgctggtacatctaaaaaatgac
tgccagttcgaggaacttgcctgtgtgcgcgctgactgcaaagagaaggtgctgaggaag
gatctgcgcgaccatgtggagaaggcctgcaagtaccgcgaggccacgtgcagccactgc
aagagccaggtccccatgatcaccctgcagaaacacgaggacaccgagtgtccctgcgtg
gtggtgtcgtgccctcacaagtgcagcgtgctgaccctgctgaggagcgagttgagtgca
cacttgtcagagtgtgtcaatgcccccagcacctgtagttttaagcgctatggctgcgtt
tttcaggggacgaaccagcagatcaaggcccacgaggccagctcggcggtacagcacgtc
aacctgctcaaggagtggagcaactccctggagaagaaggtttccttgctgcaaaatgaa
agtgtagaaaaaaacaagagtatacaaagtctgcacaatcagatatgtagctttgaaatt
gaaattgagagacaaaaggagatgcttcgaaataatgaatccaaaatacttcatttacag
cgagtaatagacagccaagcagagaagctaaaggagctggacaaggagatccgccccttc
cggcagaactgggaggaggccgacagcatgaagagcagcgtggagtcgctccagaaccgc
gtgaccgagctggaaagtgtggacaaaagtgccgggcaggcggctcgcaacacaggcttg
ctggagtcccagctgagccggcacgaccagatgctgagcgttcatgacatccgcctggcg
gacatggacctgcgcttccaggtcctggagaccgccagctacaacggcgtgctgatctgg
aagatccgagattataagcggcggaagcaggaggccgtgatggggaagaccctgtccctt
tacagccagcctttctacacgggctattttggctataagatgtgcgccagggtctacctg
aatggggacgggatggggaaggggacacacttgtcactgttctttgtcatcatgcgtgga
gagtatgatgccttgcttccttggccgtttaagcagaaagtgacgctcatgttaatggat
caggggtcctcgcggcgccacctgggagacgcgttcaagcctgaccccaacagcagcagc
ttccggaagcccacaggggagatgaacatcgcctctggctgccccgtctttgtggcccaa
actgtcctggaaaacgggacgtatattaaagatgatacaatttttattaaagtcatagtg
gatacttcggatctgcccgacccctga

DBGET integrated database retrieval system