KEGG   Oryctolagus cuniculus (rabbit): 100359222
Entry
100359222         CDS       T03373                                 

Symbol
MCL1
Name
(RefSeq) BCL2 family apoptosis regulator
  KO
K02539  myeloid leukemia cell differntiation protein MCL-1
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04151  PI3K-Akt signaling pathway
ocu04210  Apoptosis
ocu04630  JAK-STAT signaling pathway
ocu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100359222 (MCL1)
   04151 PI3K-Akt signaling pathway
    100359222 (MCL1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100359222 (MCL1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100359222 (MCL1)
SSDB
Motif
Pfam: Bcl-2 Bcl-2_3
Other DBs
NCBI-GeneID: 100359222
NCBI-ProteinID: XP_002715631
Ensembl: ENSOCUG00000012152
UniProt: G1T2Q0
LinkDB
Position
13
AA seq 352 aa
MAMFSLRRNAVIGLNLYLGGPGLGAGGGGVAPPAERLLAAEKEAAARLEVGGGEAGAVIG
GSPGASPPAALAPDARRVARPAPIGAELPDVSATPARLLYLAPTRRASPLEEMEAPAADA
IMSPEEELDGYEPEPLAKRPAVLPLLDLVGEASKVPSTDGSLPSTPPPAEEEEDELYRQS
LEIIARYLREQATGAKDAKPMGRAGSASRKALETLRRVGDGVQRNHETAFQGMLRKLDIK
NEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVL
VRTKRDWLVKQRGWDGFVEFFHVEDLESGIRNVLLAFAGVAGVGAGLAYLIR
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggcgatgtttagcctgagaagaaacgcggtaatcggactcaacctctacttggggggg
cccgggttgggagccggtggcggcggcgtcgcccctccggcagagcggcttttggctgcg
gagaaggaggccgcggcccggctagaggtagggggaggggaggccggcgcggtgattggc
ggaagcccgggcgctagccccccggccgcgctggcgccggacgcccggagggtcgcgcgg
ccggcgcccattggcgccgagctccccgacgtcagcgcgacccccgcgaggctgctgtac
ttggcgcccacccgccgcgcgtcgccgctcgaggagatggaagccccggctgcggacgcc
atcatgtcgcccgaagaggagctggacggctacgagccggagccccttgcgaagcggccg
gccgtcctgcccctgctggacttggtgggggaggccagtaaggtccctagcacggacggg
tcgctgccctcgacgccgccgcccgcagaggaggaggaggacgagttgtaccggcagtcg
ctggagattatcgcccggtaccttcgggagcaggcgaccggcgccaaggacgcgaagccg
atgggccgggccggcagcgcgagccggaaggcgctcgagaccctgcggcgggtcggggac
ggtgtgcagcgcaaccacgagacggccttccaaggaatgcttcggaaactggacatcaaa
aacgaagacgatgtcaaatctttgtctcgagtgatggtccatgttttcagtgatggcgta
acaaactggggcaggattgtgactctgatttctttcggtgcctttgtggccaaacacttg
aagagcataaaccaagaaagctgcatagaacctttagcggaaagtatcacagatgttctc
gtcaggacgaaacgggactggctagtcaaacaaagaggctgggatgggtttgtggagttc
ttccatgtagaggacctagaaagcggcatcagaaatgtgctgctggcttttgcgggtgtt
gccggagtaggagcggggctggcttatctgataagatag

DBGET integrated database retrieval system