Oryctolagus cuniculus (rabbit): 103345545 Help Entry 103345545         CDS       T03373                                  Symbol CXCL12 Name (RefSeq) C-X-C motif chemokine ligand 12   KO K10031   C-X-C motif chemokine 12 Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu04060   Cytokine-cytokine receptor interaction ocu04061   Viral protein interaction with cytokine and cytokine receptor ocu04062   Chemokine signaling pathway ocu04064   NF-kappa B signaling pathway ocu04360   Axon guidance ocu04670   Leukocyte transendothelial migration ocu04672   Intestinal immune network for IgA production ocu04810   Regulation of actin cytoskeleton ocu05163   Human cytomegalovirus infection ocu05200   Pathways in cancer ocu05323   Rheumatoid arthritis Brite KEGG Orthology (KO) [BR:ocu00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     103345545 (CXCL12)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     103345545 (CXCL12)    04061 Viral protein interaction with cytokine and cytokine receptor     103345545 (CXCL12)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     103345545 (CXCL12)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     103345545 (CXCL12)    04672 Intestinal immune network for IgA production     103345545 (CXCL12)    04062 Chemokine signaling pathway     103345545 (CXCL12)   09158 Development and regeneration    04360 Axon guidance     103345545 (CXCL12)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103345545 (CXCL12)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     103345545 (CXCL12)   09163 Immune disease    05323 Rheumatoid arthritis     103345545 (CXCL12)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and growth factors [BR:ocu04052]     103345545 (CXCL12)    00536 Glycosaminoglycan binding proteins [BR:ocu00536]     103345545 (CXCL12) Cytokines and growth factors [BR:ocu04052]  Cytokines   Chemokines    103345545 (CXCL12) Glycosaminoglycan binding proteins [BR:ocu00536]  Heparan sulfate / Heparin   Chemokines    103345545 (CXCL12) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  103345545 NCBI-ProteinID:  XP_008248332 LinkDB All DBs Position Un Genome browser AA seq 93 aa AA seqDB search MDAKVVAVLALVLAALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIV ARLKSNNRQVCIDPKLKWIQEYLEKALNKRFKM NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggacgccaaggttgtcgccgtgctggcccttgtgctggccgcgctctgtctcagcgat gggaaacccgtcagcctgagctacagatgcccctgccgattcttcgagagccacgtggcc agagccaacgtcaagcatctcaagatcctcaacacgcccaactgtgccctgcagatcgtg gcacggctgaagagcaacaaccgacaagtgtgcattgatccgaagctaaagtggattcag gagtacctggagaaagccttaaacaagaggttcaagatgtga

DBGET integrated database retrieval system