KEGG   Oryctolagus cuniculus (rabbit): 103345545
Entry
103345545         CDS       T03373                                 
Symbol
CXCL12
Name
(RefSeq) C-X-C motif chemokine ligand 12
  KO
K10031  C-X-C motif chemokine 12
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04060  Cytokine-cytokine receptor interaction
ocu04061  Viral protein interaction with cytokine and cytokine receptor
ocu04062  Chemokine signaling pathway
ocu04064  NF-kappa B signaling pathway
ocu04360  Axon guidance
ocu04670  Leukocyte transendothelial migration
ocu04672  Intestinal immune network for IgA production
ocu04810  Regulation of actin cytoskeleton
ocu05163  Human cytomegalovirus infection
ocu05200  Pathways in cancer
ocu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    103345545 (CXCL12)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103345545 (CXCL12)
   04061 Viral protein interaction with cytokine and cytokine receptor
    103345545 (CXCL12)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103345545 (CXCL12)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    103345545 (CXCL12)
   04672 Intestinal immune network for IgA production
    103345545 (CXCL12)
   04062 Chemokine signaling pathway
    103345545 (CXCL12)
  09158 Development and regeneration
   04360 Axon guidance
    103345545 (CXCL12)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103345545 (CXCL12)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    103345545 (CXCL12)
  09163 Immune disease
   05323 Rheumatoid arthritis
    103345545 (CXCL12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ocu04052]
    103345545 (CXCL12)
   00536 Glycosaminoglycan binding proteins [BR:ocu00536]
    103345545 (CXCL12)
Cytokines and growth factors [BR:ocu04052]
 Cytokines
  Chemokines
   103345545 (CXCL12)
Glycosaminoglycan binding proteins [BR:ocu00536]
 Heparan sulfate / Heparin
  Chemokines
   103345545 (CXCL12)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 103345545
NCBI-ProteinID: XP_008248332
LinkDB
Position
Un
AA seq 93 aa
MDAKVVAVLALVLAALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIV
ARLKSNNRQVCIDPKLKWIQEYLEKALNKRFKM
NT seq 282 nt   +upstreamnt  +downstreamnt
atggacgccaaggttgtcgccgtgctggcccttgtgctggccgcgctctgtctcagcgat
gggaaacccgtcagcctgagctacagatgcccctgccgattcttcgagagccacgtggcc
agagccaacgtcaagcatctcaagatcctcaacacgcccaactgtgccctgcagatcgtg
gcacggctgaagagcaacaaccgacaagtgtgcattgatccgaagctaaagtggattcag
gagtacctggagaaagccttaaacaagaggttcaagatgtga

DBGET integrated database retrieval system