Oryctolagus cuniculus (rabbit): 103349397 Help Entry 103349397         CDS       T03373                                  Name (RefSeq) apoptosis regulator Bcl-2   KO K02161   apoptosis regulator Bcl-2 Organism ocu  Oryctolagus cuniculus (rabbit) Pathway ocu01521   EGFR tyrosine kinase inhibitor resistance ocu01522   Endocrine resistance ocu01524   Platinum drug resistance ocu04064   NF-kappa B signaling pathway ocu04066   HIF-1 signaling pathway ocu04071   Sphingolipid signaling pathway ocu04115   p53 signaling pathway ocu04140   Autophagy - animal ocu04141   Protein processing in endoplasmic reticulum ocu04151   PI3K-Akt signaling pathway ocu04210   Apoptosis ocu04215   Apoptosis - multiple species ocu04217   Necroptosis ocu04261   Adrenergic signaling in cardiomyocytes ocu04340   Hedgehog signaling pathway ocu04510   Focal adhesion ocu04621   NOD-like receptor signaling pathway ocu04630   JAK-STAT signaling pathway ocu04722   Neurotrophin signaling pathway ocu04725   Cholinergic synapse ocu04915   Estrogen signaling pathway ocu04928   Parathyroid hormone synthesis, secretion and action ocu04933   AGE-RAGE signaling pathway in diabetic complications ocu05014   Amyotrophic lateral sclerosis ocu05022   Pathways of neurodegeneration - multiple diseases ocu05132   Salmonella infection ocu05145   Toxoplasmosis ocu05152   Tuberculosis ocu05161   Hepatitis B ocu05162   Measles ocu05168   Herpes simplex virus 1 infection ocu05169   Epstein-Barr virus infection ocu05170   Human immunodeficiency virus 1 infection ocu05200   Pathways in cancer ocu05206   MicroRNAs in cancer ocu05207   Chemical carcinogenesis - receptor activation ocu05210   Colorectal cancer ocu05215   Prostate cancer ocu05222   Small cell lung cancer ocu05226   Gastric cancer ocu05417   Lipid and atherosclerosis ocu05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:ocu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     103349397  09130 Environmental Information Processing   09132 Signal transduction    04340 Hedgehog signaling pathway     103349397    04630 JAK-STAT signaling pathway     103349397    04064 NF-kappa B signaling pathway     103349397    04066 HIF-1 signaling pathway     103349397    04071 Sphingolipid signaling pathway     103349397    04151 PI3K-Akt signaling pathway     103349397  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     103349397   09143 Cell growth and death    04210 Apoptosis     103349397    04215 Apoptosis - multiple species     103349397    04217 Necroptosis     103349397    04115 p53 signaling pathway     103349397   09144 Cellular community - eukaryotes    04510 Focal adhesion     103349397  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     103349397   09152 Endocrine system    04915 Estrogen signaling pathway     103349397    04928 Parathyroid hormone synthesis, secretion and action     103349397   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     103349397   09156 Nervous system    04725 Cholinergic synapse     103349397    04722 Neurotrophin signaling pathway     103349397  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     103349397    05206 MicroRNAs in cancer     103349397    05207 Chemical carcinogenesis - receptor activation     103349397   09162 Cancer: specific types    05210 Colorectal cancer     103349397    05226 Gastric cancer     103349397    05215 Prostate cancer     103349397    05222 Small cell lung cancer     103349397   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     103349397    05161 Hepatitis B     103349397    05162 Measles     103349397    05168 Herpes simplex virus 1 infection     103349397    05169 Epstein-Barr virus infection     103349397   09171 Infectious disease: bacterial    05132 Salmonella infection     103349397    05152 Tuberculosis     103349397   09174 Infectious disease: parasitic    05145 Toxoplasmosis     103349397   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     103349397    05022 Pathways of neurodegeneration - multiple diseases     103349397   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     103349397    05418 Fluid shear stress and atherosclerosis     103349397   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     103349397   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     103349397    01524 Platinum drug resistance     103349397    01522 Endocrine resistance     103349397  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ocu01009]     103349397 Protein phosphatases and associated proteins [BR:ocu01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      103349397 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 ARMH5 Motif Other DBs NCBI-GeneID:  103349397 NCBI-ProteinID:  XP_008259661 Ensembl:  ENSOCUG00000025312 UniProt:  G1TW27 LinkDB All DBs Position 9:12635739..12805678 Genome browser AA seq 226 aa AA seqDB search MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAASAPGVFSSQPAPAAPRDPAART SPPPPPAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATV VEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNG GWDAFVELYGPSVRPLSDFSWVSLKTLFSLALIGACITLGAYLGHK NT seq 681 nt NT seq  +upstreamnt  +downstreamnt atggcgcacgccgggcgaacagggtacgacaaccgggagatcgtgatgaagtacatccac tataagctgtcccagaggggctacgagtgggacgctggggacgcgggcgccgcctccgcg ccgggcgtcttctcctcccagcccgcgcccgctgcgccccgggacccggccgccaggacc tcgccgccgccgccgccggccgccgcggggcccgcgctcagcccggtgccacctgtggtc cacctgaccctccgccaggcgggcgacgacttctcccggcgctaccgccgcgacttcgcg gagatgtccagccagctgcacctgacgcccttcaccgcgagggggcgctttgccacggtg gtggaggagctcttcagggatggggtgaactgggggaggattgtggccttctttgagttc ggtggggtcatgtgtgtggagagcgtcaaccgggagatgtcgcccctggtggacaacatc gccctgtggatgactgagtacctgaaccggcacctgcacacctggatccaggataatgga ggctgggatgccttcgtggaactgtacggccccagcgtgcggcctctgtcagacttctcc tgggtgtctctgaagactttgttcagcctggccctgataggagcttgcatcaccctcggt gcctacctgggccacaagtga

DBGET integrated database retrieval system