KEGG   Oryctolagus cuniculus (rabbit): 103350405
Entry
103350405         CDS       T03373                                 
Symbol
RNF7
Name
(RefSeq) ring finger protein 7
  KO
K10611  RING-box protein 2
Organism
ocu  Oryctolagus cuniculus (rabbit)
Pathway
ocu04120  Ubiquitin mediated proteolysis
ocu05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:ocu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    103350405 (RNF7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    103350405 (RNF7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ocu04121]
    103350405 (RNF7)
Ubiquitin system [BR:ocu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul5 complex
    Ring finger protein
     103350405 (RNF7)
SSDB
Motif
Pfam: zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4_2 zf-C3HC4_3 zf-C3HC4
Other DBs
NCBI-GeneID: 103350405
NCBI-ProteinID: XP_008264483
LinkDB
Position
14:35207210..35214694
AA seq 113 aa
MADVEDGEETCALSSHSGSTGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDA
CLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK
NT seq 342 nt   +upstreamnt  +downstreamnt
atggccgacgtggaagacggcgaggagacctgcgccctgtcctctcactccgggagcaca
ggctccaagtcggggggcgacaaaatgttctctctcaagaagtggaacgcggtggccatg
tggagctgggacgtggagtgcgatacgtgcgccatctgcagggtccaagtgatggatgcc
tgtcttagatgtcaagctgaaaacaaacaagaagattgtgttgtggtgtggggagagtgt
aaccattccttccacaactgctgcatgtccctctgggtgaagcagaacaatcgctgcccg
ctctgccagcaggactgggtggtgcagagaatcggcaagtga

DBGET integrated database retrieval system