Oryx dammah (scimitar-horned oryx): 120852702 Help Entry 120852702         CDS       T07255                                  Symbol FOS Name (RefSeq) proto-oncogene c-Fos   KO K04379   proto-oncogene protein c-fos Organism oda  Oryx dammah (scimitar-horned oryx) Pathway oda01522   Endocrine resistance oda04010   MAPK signaling pathway oda04024   cAMP signaling pathway oda04210   Apoptosis oda04380   Osteoclast differentiation oda04620   Toll-like receptor signaling pathway oda04657   IL-17 signaling pathway oda04658   Th1 and Th2 cell differentiation oda04659   Th17 cell differentiation oda04660   T cell receptor signaling pathway oda04662   B cell receptor signaling pathway oda04668   TNF signaling pathway oda04713   Circadian entrainment oda04725   Cholinergic synapse oda04728   Dopaminergic synapse oda04915   Estrogen signaling pathway oda04917   Prolactin signaling pathway oda04921   Oxytocin signaling pathway oda04926   Relaxin signaling pathway oda04928   Parathyroid hormone synthesis, secretion and action oda04932   Non-alcoholic fatty liver disease oda04935   Growth hormone synthesis, secretion and action oda05031   Amphetamine addiction oda05132   Salmonella infection oda05133   Pertussis oda05135   Yersinia infection oda05140   Leishmaniasis oda05142   Chagas disease oda05161   Hepatitis B oda05162   Measles oda05166   Human T-cell leukemia virus 1 infection oda05167   Kaposi sarcoma-associated herpesvirus infection oda05170   Human immunodeficiency virus 1 infection oda05171   Coronavirus disease - COVID-19 oda05200   Pathways in cancer oda05207   Chemical carcinogenesis - receptor activation oda05208   Chemical carcinogenesis - reactive oxygen species oda05210   Colorectal cancer oda05224   Breast cancer oda05231   Choline metabolism in cancer oda05235   PD-L1 expression and PD-1 checkpoint pathway in cancer oda05323   Rheumatoid arthritis oda05417   Lipid and atherosclerosis oda05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:oda00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     120852702 (FOS)    04668 TNF signaling pathway     120852702 (FOS)    04024 cAMP signaling pathway     120852702 (FOS)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     120852702 (FOS)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     120852702 (FOS)    04660 T cell receptor signaling pathway     120852702 (FOS)    04658 Th1 and Th2 cell differentiation     120852702 (FOS)    04659 Th17 cell differentiation     120852702 (FOS)    04657 IL-17 signaling pathway     120852702 (FOS)    04662 B cell receptor signaling pathway     120852702 (FOS)   09152 Endocrine system    04915 Estrogen signaling pathway     120852702 (FOS)    04917 Prolactin signaling pathway     120852702 (FOS)    04921 Oxytocin signaling pathway     120852702 (FOS)    04926 Relaxin signaling pathway     120852702 (FOS)    04935 Growth hormone synthesis, secretion and action     120852702 (FOS)    04928 Parathyroid hormone synthesis, secretion and action     120852702 (FOS)   09156 Nervous system    04725 Cholinergic synapse     120852702 (FOS)    04728 Dopaminergic synapse     120852702 (FOS)   09158 Development and regeneration    04380 Osteoclast differentiation     120852702 (FOS)   09159 Environmental adaptation    04713 Circadian entrainment     120852702 (FOS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     120852702 (FOS)    05207 Chemical carcinogenesis - receptor activation     120852702 (FOS)    05208 Chemical carcinogenesis - reactive oxygen species     120852702 (FOS)    05231 Choline metabolism in cancer     120852702 (FOS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     120852702 (FOS)   09162 Cancer: specific types    05210 Colorectal cancer     120852702 (FOS)    05224 Breast cancer     120852702 (FOS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     120852702 (FOS)    05170 Human immunodeficiency virus 1 infection     120852702 (FOS)    05161 Hepatitis B     120852702 (FOS)    05171 Coronavirus disease - COVID-19     120852702 (FOS)    05162 Measles     120852702 (FOS)    05167 Kaposi sarcoma-associated herpesvirus infection     120852702 (FOS)   09171 Infectious disease: bacterial    05132 Salmonella infection     120852702 (FOS)    05135 Yersinia infection     120852702 (FOS)    05133 Pertussis     120852702 (FOS)   09174 Infectious disease: parasitic    05140 Leishmaniasis     120852702 (FOS)    05142 Chagas disease     120852702 (FOS)   09163 Immune disease    05323 Rheumatoid arthritis     120852702 (FOS)   09165 Substance dependence    05031 Amphetamine addiction     120852702 (FOS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     120852702 (FOS)    05418 Fluid shear stress and atherosclerosis     120852702 (FOS)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     120852702 (FOS)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     120852702 (FOS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:oda03000]     120852702 (FOS)    04131 Membrane trafficking [BR:oda04131]     120852702 (FOS) Transcription factors [BR:oda03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     120852702 (FOS) Membrane trafficking [BR:oda04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     120852702 (FOS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 DUF3450 HALZ Macoilin Motif Other DBs NCBI-GeneID:  120852702 NCBI-ProteinID:  XP_040081999 LinkDB All DBs Position Unknown AA seq 380 aa AA seqDB search MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDYCTDLAASSANF IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPTPSAGAYSRAGVMKTVTGGRA QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLSGGLPEAATPESEEAFT LPLLNDPEPKPSVEPVKSVGSMELKAEPFDDFMFPASSRPSGSETARSVPDMDLSGSFYA ADWEPLHGGSLGLGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRK GSSSNEPSSDSLSSPTLLAL NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt atgatgttctctggcttcaacgccgactacgaggcgtcctcctcccgctgcagcagcgcc tccccggccggggacagtctctcctactaccactcaccggccgactccttctccagcatg ggttctcccgtcaatgcgcaggactactgcaccgatctggccgcttccagtgccaacttc atcccaacagtgactgccatctcgaccagccctgacctacaatggctagtgcagcccacc ctggtctcctccgtggccccgtcccagaccagagccccccacccctatggagtccctact ccctcagctggggcttactccagggctggagtcatgaaaaccgtgacgggaggcagagct cagagcattggccggaggggcaaggtagaacagttgtccccagaagaagaagagaaaagg agaatccgaagggaaaggaataagatggctgcagccaaatgccggaaccggaggagagag ctgactgacaccctccaagcggagacagaccaactagaagatgagaagtcggctttgcag acagagattgccaatctgctgaaggagaaggaaaaactcgagttcatcctagcggctcac cgacctgcctgcaagatccctgacgacctgggcttcccagaagagatgtctgtggcttcc cttgatctgagtgggggcctgcctgaggctgccacccctgaatctgaggaggccttcacc ctgcccctcctcaatgaccctgagcccaagccctcagtggagcccgtcaagagtgtcggc agcatggagctgaaggctgagccctttgatgacttcatgttcccagcgtcatccaggccc agcggctcggagaccgcccgctctgtgccagacatggacctgtctggttccttctatgca gcagactgggagcccctgcacggtggctccctggggctggggccaatggccacggagctg gagcccctgtgcaccccggtggtcacctgtactcccagctgcactgcttacacgtcttcc ttcgtcttcacctaccccgaggctgactccttccccagctgtgcggctgcccaccgcaag ggcagcagcagcaacgagccttcctctgactcgctcagctcacccacactgctggccctg tga

DBGET integrated database retrieval system