Oryx dammah (scimitar-horned oryx): 120857713 Help Entry 120857713         CDS       T07255                                  Symbol RAP1B Name (RefSeq) ras-related protein Rap-1b   KO K07836   Ras-related protein Rap-1B Organism oda  Oryx dammah (scimitar-horned oryx) Pathway oda04010   MAPK signaling pathway oda04014   Ras signaling pathway oda04015   Rap1 signaling pathway oda04024   cAMP signaling pathway oda04062   Chemokine signaling pathway oda04510   Focal adhesion oda04520   Adherens junction oda04611   Platelet activation oda04670   Leukocyte transendothelial migration oda04720   Long-term potentiation oda04722   Neurotrophin signaling pathway oda04934   Cushing syndrome oda04972   Pancreatic secretion oda05211   Renal cell carcinoma oda05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:oda00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     120857713 (RAP1B)    04014 Ras signaling pathway     120857713 (RAP1B)    04015 Rap1 signaling pathway     120857713 (RAP1B)    04024 cAMP signaling pathway     120857713 (RAP1B)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     120857713 (RAP1B)    04520 Adherens junction     120857713 (RAP1B)  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     120857713 (RAP1B)    04670 Leukocyte transendothelial migration     120857713 (RAP1B)    04062 Chemokine signaling pathway     120857713 (RAP1B)   09154 Digestive system    04972 Pancreatic secretion     120857713 (RAP1B)   09156 Nervous system    04720 Long-term potentiation     120857713 (RAP1B)    04722 Neurotrophin signaling pathway     120857713 (RAP1B)  09160 Human Diseases   09162 Cancer: specific types    05211 Renal cell carcinoma     120857713 (RAP1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     120857713 (RAP1B)   09167 Endocrine and metabolic disease    04934 Cushing syndrome     120857713 (RAP1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oda04147]     120857713 (RAP1B)    04031 GTP-binding proteins [BR:oda04031]     120857713 (RAP1B) Exosome [BR:oda04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120857713 (RAP1B)   Exosomal proteins of other body fluids (saliva and urine)    120857713 (RAP1B)   Exosomal proteins of colorectal cancer cells    120857713 (RAP1B) GTP-binding proteins [BR:oda04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     120857713 (RAP1B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 G-alpha Motif Other DBs NCBI-GeneID:  120857713 NCBI-ProteinID:  XP_040089340 LinkDB All DBs Position Unknown AA seq 184 aa AA seqDB search MREYKLVVLGSGGVGKSALTVQFVQGIFVEKYDPTIEDSYRKQVEVDAQQCMLEILDTAG TEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDL EDERVVGKEQGQNLARQWNNCAFLESSAKSKINVNEIFYDLVRQINRKTPVPGKARKKSS CQLL NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgcgtgagtataagctagtcgttcttggctcgggaggcgttggaaaatctgctctgact gtacagtttgttcaaggaatttttgttgaaaaatatgatcctacgatagaagattcttat aggaagcaagttgaagttgatgcacagcagtgtatgcttgaaatcttggatactgcagga acggaacaattcacagcaatgagggatttgtacatgaaaaatggacaaggctttgcatta gtttattccatcacagcgcagtccacatttaatgatttacaagatctgagagaacagatt cttcgagttaaagacacggatgatgttccaatgattctggttggtaataagtgcgacttg gaagatgaaagagttgtaggaaaggaacaaggtcaaaatctagcacgacagtggaacaac tgtgcattcttagaatcctctgcaaaatcaaaaataaatgttaatgagatcttttatgac ctagtgcgacaaattaacagaaaaactccagtgcctgggaaggctcgcaaaaagtcatca tgtcagctgctttaa

DBGET integrated database retrieval system