Oryx dammah (scimitar-horned oryx): 120862218 Help Entry 120862218         CDS       T07255                                  Name (RefSeq) interferon beta-2   KO K05415   interferon beta Organism oda  Oryx dammah (scimitar-horned oryx) Pathway oda04060   Cytokine-cytokine receptor interaction oda04151   PI3K-Akt signaling pathway oda04217   Necroptosis oda04380   Osteoclast differentiation oda04620   Toll-like receptor signaling pathway oda04621   NOD-like receptor signaling pathway oda04622   RIG-I-like receptor signaling pathway oda04623   Cytosolic DNA-sensing pathway oda04630   JAK-STAT signaling pathway oda04650   Natural killer cell mediated cytotoxicity oda04668   TNF signaling pathway oda04936   Alcoholic liver disease oda05135   Yersinia infection oda05142   Chagas disease oda05152   Tuberculosis oda05160   Hepatitis C oda05161   Hepatitis B oda05162   Measles oda05163   Human cytomegalovirus infection oda05164   Influenza A oda05165   Human papillomavirus infection oda05167   Kaposi sarcoma-associated herpesvirus infection oda05168   Herpes simplex virus 1 infection oda05169   Epstein-Barr virus infection oda05170   Human immunodeficiency virus 1 infection oda05171   Coronavirus disease - COVID-19 oda05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:oda00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     120862218    04668 TNF signaling pathway     120862218    04151 PI3K-Akt signaling pathway     120862218   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     120862218  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     120862218  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     120862218    04621 NOD-like receptor signaling pathway     120862218    04622 RIG-I-like receptor signaling pathway     120862218    04623 Cytosolic DNA-sensing pathway     120862218    04650 Natural killer cell mediated cytotoxicity     120862218   09158 Development and regeneration    04380 Osteoclast differentiation     120862218  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     120862218    05161 Hepatitis B     120862218    05160 Hepatitis C     120862218    05171 Coronavirus disease - COVID-19     120862218    05164 Influenza A     120862218    05162 Measles     120862218    05168 Herpes simplex virus 1 infection     120862218    05163 Human cytomegalovirus infection     120862218    05167 Kaposi sarcoma-associated herpesvirus infection     120862218    05169 Epstein-Barr virus infection     120862218    05165 Human papillomavirus infection     120862218   09171 Infectious disease: bacterial    05135 Yersinia infection     120862218    05152 Tuberculosis     120862218   09174 Infectious disease: parasitic    05142 Chagas disease     120862218   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     120862218   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     120862218  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oda04052]     120862218 Cytokines and neuropeptides [BR:oda04052]  Cytokines   Interferons    120862218 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon Hormone_1 Aip3p_Bud6_N SpecificRecomb PrlF_antitoxin Motif Other DBs NCBI-GeneID:  120862218 NCBI-ProteinID:  XP_040094278 LinkDB All DBs Position Unknown AA seq 186 aa AA seqDB search MTYRCLLQMVLLLCLSTTALSRSYSLLRFQQRRSSVVCQNLLRQLPSTPQHCLQFRMDFQ VPEEMKQAQQFQKEDAVLVMYEMLQQIFNILTRDFSSTGWSDTIIEHLLEQLYGQMNRLE PILKEIMQKQNSTMGDTTVLHLQKYYFNLVQYLKSKEYNRCAWTVVQVQILRNFSFLRRL TGYLRD NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgacctaccggtgcctcctccagatggttctcctgctgtgtctctccaccacagctctt tccaggagctacagcttgcttcgattccaacagaggcggagctctgtggtgtgtcagaac ctcctgcggcagttaccttcaactcctcaacactgcctccagttcaggatggacttccag gtccctgaggagatgaagcaagcacagcagttccagaaggaagacgccgtattggtcatg tatgagatgctccagcagatcttcaacattctcaccagagacttctccagcactggctgg tctgacaccatcattgagcacctccttgagcaactctatgggcagatgaatcgtctggag ccaatcctgaaggaaataatgcagaagcaaaactccactatgggagacacgaccgttctt cacctgcagaaatattacttcaacctggtgcagtacctgaagtccaaggagtacaacagg tgtgcctggacagtcgtgcaagtacaaatactcaggaacttttctttcctgaggagacta acaggttacctccgtgactga

DBGET integrated database retrieval system