Oryx dammah (scimitar-horned oryx): 120864752 Help Entry 120864752         CDS       T07255                                  Symbol IL4 Name (RefSeq) interleukin-4   KO K05430   interleukin 4 Organism oda  Oryx dammah (scimitar-horned oryx) Pathway oda04060   Cytokine-cytokine receptor interaction oda04151   PI3K-Akt signaling pathway oda04630   JAK-STAT signaling pathway oda04640   Hematopoietic cell lineage oda04657   IL-17 signaling pathway oda04658   Th1 and Th2 cell differentiation oda04659   Th17 cell differentiation oda04660   T cell receptor signaling pathway oda04664   Fc epsilon RI signaling pathway oda04672   Intestinal immune network for IgA production oda05140   Leishmaniasis oda05200   Pathways in cancer oda05310   Asthma oda05320   Autoimmune thyroid disease oda05321   Inflammatory bowel disease oda05330   Allograft rejection Brite KEGG Orthology (KO) [BR:oda00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     120864752 (IL4)    04151 PI3K-Akt signaling pathway     120864752 (IL4)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     120864752 (IL4)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     120864752 (IL4)    04660 T cell receptor signaling pathway     120864752 (IL4)    04658 Th1 and Th2 cell differentiation     120864752 (IL4)    04659 Th17 cell differentiation     120864752 (IL4)    04657 IL-17 signaling pathway     120864752 (IL4)    04664 Fc epsilon RI signaling pathway     120864752 (IL4)    04672 Intestinal immune network for IgA production     120864752 (IL4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     120864752 (IL4)   09174 Infectious disease: parasitic    05140 Leishmaniasis     120864752 (IL4)   09163 Immune disease    05310 Asthma     120864752 (IL4)    05320 Autoimmune thyroid disease     120864752 (IL4)    05321 Inflammatory bowel disease     120864752 (IL4)    05330 Allograft rejection     120864752 (IL4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oda04052]     120864752 (IL4)    00536 Glycosaminoglycan binding proteins [BR:oda00536]     120864752 (IL4) Cytokines and neuropeptides [BR:oda04052]  Cytokines   Interleukins    120864752 (IL4) Glycosaminoglycan binding proteins [BR:oda00536]  Heparan sulfate / Heparin   Cytokines    120864752 (IL4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL4 Motif Other DBs NCBI-GeneID:  120864752 NCBI-ProteinID:  XP_040097761 LinkDB All DBs Position Unknown AA seq 135 aa AA seqDB search MGLISQLIPALVCLLVCTSHFVHGHKCDITLEEIIKTLNILTSRKNSCMELPVADVFAAP KNTTEKETFCRAGIELRRIYRSHMCLNKFLGGLDRNLSSLASKTCSVNEAKTSTSTLKDL LERLKTIMKEKYSKC NT seq 408 nt NT seq  +upstreamnt  +downstreamnt atgggtctcatctcccagctgatcccagcgctcgtctgcttactggtatgtaccagccac ttcgtccatggacacaagtgtgatattaccttagaagagatcatcaaaacgctgaacatc ctcacatcgagaaagaattcatgcatggagctgcctgtagcagacgtctttgctgcccca aagaacacaactgagaaggaaaccttctgcagggctggaattgagctcaggcgtatctac aggagccacatgtgcttgaacaaattcctgggcggacttgacaggaatctcagcagcttg gcaagcaagacctgttctgtgaatgaagccaagacgagtacaagtacgctgaaagacctc ttggaaaggctaaagactattatgaaggagaaatactcaaagtgttga

DBGET integrated database retrieval system