Oryx dammah (scimitar-horned oryx): 120874545 Help Entry 120874545         CDS       T07255                                  Symbol TMEM258 Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism oda  Oryx dammah (scimitar-horned oryx) Pathway oda00510   N-Glycan biosynthesis oda00513   Various types of N-glycan biosynthesis oda04141   Protein processing in endoplasmic reticulum Module oda_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:oda00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     120874545 (TMEM258)    00513 Various types of N-glycan biosynthesis     120874545 (TMEM258)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     120874545 (TMEM258) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ost5 DUF6512 TctB Phage_holin_3_3 Motif Other DBs NCBI-GeneID:  120874545 NCBI-ProteinID:  XP_040111924 LinkDB All DBs Position Unknown AA seq 79 aa AA seqDB search MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVA SLFMGFGVLFLLLWVGIYI NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggaacttgaggccatgagcagatacaccagccccgtgaacccggctgtctttccccac ctgaccgtcgtgctgctggccattggcatgttcttcaccgcctggttcttcgtttatgag gtcacatccaccaagtacacccgggatatctacaaagagctcctcatctccctggtggcc tcactcttcatgggctttggagtcctcttcctgctgctctgggtcggcatctacatatga

DBGET integrated database retrieval system