Oryx dammah (scimitar-horned oryx): 120878073 Help Entry 120878073         CDS       T07255                                  Symbol IL6 Name (RefSeq) interleukin-6   KO K05405   interleukin 6 Organism oda  Oryx dammah (scimitar-horned oryx) Pathway oda01521   EGFR tyrosine kinase inhibitor resistance oda01523   Antifolate resistance oda04060   Cytokine-cytokine receptor interaction oda04061   Viral protein interaction with cytokine and cytokine receptor oda04066   HIF-1 signaling pathway oda04068   FoxO signaling pathway oda04151   PI3K-Akt signaling pathway oda04218   Cellular senescence oda04620   Toll-like receptor signaling pathway oda04621   NOD-like receptor signaling pathway oda04623   Cytosolic DNA-sensing pathway oda04625   C-type lectin receptor signaling pathway oda04630   JAK-STAT signaling pathway oda04640   Hematopoietic cell lineage oda04657   IL-17 signaling pathway oda04659   Th17 cell differentiation oda04668   TNF signaling pathway oda04672   Intestinal immune network for IgA production oda04931   Insulin resistance oda04932   Non-alcoholic fatty liver disease oda04933   AGE-RAGE signaling pathway in diabetic complications oda04936   Alcoholic liver disease oda05010   Alzheimer disease oda05020   Prion disease oda05022   Pathways of neurodegeneration - multiple diseases oda05132   Salmonella infection oda05133   Pertussis oda05134   Legionellosis oda05135   Yersinia infection oda05142   Chagas disease oda05143   African trypanosomiasis oda05144   Malaria oda05146   Amoebiasis oda05152   Tuberculosis oda05161   Hepatitis B oda05162   Measles oda05163   Human cytomegalovirus infection oda05164   Influenza A oda05166   Human T-cell leukemia virus 1 infection oda05167   Kaposi sarcoma-associated herpesvirus infection oda05168   Herpes simplex virus 1 infection oda05169   Epstein-Barr virus infection oda05171   Coronavirus disease - COVID-19 oda05200   Pathways in cancer oda05202   Transcriptional misregulation in cancer oda05321   Inflammatory bowel disease oda05323   Rheumatoid arthritis oda05332   Graft-versus-host disease oda05410   Hypertrophic cardiomyopathy oda05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:oda00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     120878073 (IL6)    04668 TNF signaling pathway     120878073 (IL6)    04066 HIF-1 signaling pathway     120878073 (IL6)    04068 FoxO signaling pathway     120878073 (IL6)    04151 PI3K-Akt signaling pathway     120878073 (IL6)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     120878073 (IL6)    04061 Viral protein interaction with cytokine and cytokine receptor     120878073 (IL6)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     120878073 (IL6)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     120878073 (IL6)    04620 Toll-like receptor signaling pathway     120878073 (IL6)    04621 NOD-like receptor signaling pathway     120878073 (IL6)    04623 Cytosolic DNA-sensing pathway     120878073 (IL6)    04625 C-type lectin receptor signaling pathway     120878073 (IL6)    04659 Th17 cell differentiation     120878073 (IL6)    04657 IL-17 signaling pathway     120878073 (IL6)    04672 Intestinal immune network for IgA production     120878073 (IL6)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     120878073 (IL6)    05202 Transcriptional misregulation in cancer     120878073 (IL6)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     120878073 (IL6)    05161 Hepatitis B     120878073 (IL6)    05171 Coronavirus disease - COVID-19     120878073 (IL6)    05164 Influenza A     120878073 (IL6)    05162 Measles     120878073 (IL6)    05168 Herpes simplex virus 1 infection     120878073 (IL6)    05163 Human cytomegalovirus infection     120878073 (IL6)    05167 Kaposi sarcoma-associated herpesvirus infection     120878073 (IL6)    05169 Epstein-Barr virus infection     120878073 (IL6)   09171 Infectious disease: bacterial    05132 Salmonella infection     120878073 (IL6)    05135 Yersinia infection     120878073 (IL6)    05133 Pertussis     120878073 (IL6)    05134 Legionellosis     120878073 (IL6)    05152 Tuberculosis     120878073 (IL6)   09174 Infectious disease: parasitic    05146 Amoebiasis     120878073 (IL6)    05144 Malaria     120878073 (IL6)    05142 Chagas disease     120878073 (IL6)    05143 African trypanosomiasis     120878073 (IL6)   09163 Immune disease    05323 Rheumatoid arthritis     120878073 (IL6)    05321 Inflammatory bowel disease     120878073 (IL6)    05332 Graft-versus-host disease     120878073 (IL6)   09164 Neurodegenerative disease    05010 Alzheimer disease     120878073 (IL6)    05020 Prion disease     120878073 (IL6)    05022 Pathways of neurodegeneration - multiple diseases     120878073 (IL6)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     120878073 (IL6)    05410 Hypertrophic cardiomyopathy     120878073 (IL6)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     120878073 (IL6)    04932 Non-alcoholic fatty liver disease     120878073 (IL6)    04931 Insulin resistance     120878073 (IL6)    04933 AGE-RAGE signaling pathway in diabetic complications     120878073 (IL6)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     120878073 (IL6)    01523 Antifolate resistance     120878073 (IL6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oda04052]     120878073 (IL6) Cytokines and neuropeptides [BR:oda04052]  Cytokines   Interleukins    120878073 (IL6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL6 IL23 GCSF Lipoprotein_6 FAP206 MIP-T3_C Sec16 ZapB APG6_N Motif Other DBs NCBI-GeneID:  120878073 NCBI-ProteinID:  XP_040116585 LinkDB All DBs Position Unknown AA seq 237 aa AA seqDB search MRPGMSETQSALEPTRNERELHQPSRNPAMNSLFTSAFSPFAVSLGLLLVMTSAFPTPGP LGEDFKNDTTPSRLLLTTPDKTEALIKHIVDKISALRKEICEKNDECENSKETLAENKLK LPKMEEKDGCFQSGFNQAICLIKTTAGLLEYQIYLDFLQNEYEGTQENIKELQSSIRTLI QILKEKIADLITTPATNTDVLEKMQSSNEWVKNAKVIIILRSLENFLQFSLRAIRMK NT seq 714 nt NT seq  +upstreamnt  +downstreamnt atgagaccggggatgtctgagactcagtctgccctcgagcccaccaggaacgaaagagag ctccatcagccctccaggaacccagctatgaactccctcttcacaagcgccttcagtcca ttcgctgtctccctggggctgctcctggtgatgacttctgctttccctaccccgggtccc ctgggagaagatttcaaaaatgacaccaccccaagcagactacttctgaccactccagac aaaaccgaagctctcattaagcacatcgtcgacaaaatctctgcattgagaaaggagata tgtgagaagaatgacgagtgtgaaaacagcaaggagacactggcagaaaataagctgaaa cttccaaaaatggaggaaaaagatggatgcttccaatctgggttcaatcaggcgatttgc ttgatcaaaaccactgctggtcttctggagtatcagatatacctggacttcctccagaac gagtatgagggaactcaggaaaatatcaaggagttgcagagcagtatcagaacactgatc cagatcctgaaggaaaagatcgcagatctaataaccactccagccacaaacactgacgtg ctggagaagatgcagtcctcaaacgagtgggtgaagaacgcaaaggttatcatcatcctg agaagccttgagaatttcctgcagttcagcctgagagctattcggatgaagtag

DBGET integrated database retrieval system