Oryx dammah (scimitar-horned oryx): 120880862 Help Entry 120880862         CDS       T07255                                  Symbol BCL2 Name (RefSeq) apoptosis regulator Bcl-2   KO K02161   apoptosis regulator Bcl-2 Organism oda  Oryx dammah (scimitar-horned oryx) Pathway oda01521   EGFR tyrosine kinase inhibitor resistance oda01522   Endocrine resistance oda01524   Platinum drug resistance oda04064   NF-kappa B signaling pathway oda04066   HIF-1 signaling pathway oda04071   Sphingolipid signaling pathway oda04115   p53 signaling pathway oda04140   Autophagy - animal oda04141   Protein processing in endoplasmic reticulum oda04151   PI3K-Akt signaling pathway oda04210   Apoptosis oda04215   Apoptosis - multiple species oda04217   Necroptosis oda04261   Adrenergic signaling in cardiomyocytes oda04340   Hedgehog signaling pathway oda04510   Focal adhesion oda04621   NOD-like receptor signaling pathway oda04630   JAK-STAT signaling pathway oda04722   Neurotrophin signaling pathway oda04725   Cholinergic synapse oda04915   Estrogen signaling pathway oda04928   Parathyroid hormone synthesis, secretion and action oda04933   AGE-RAGE signaling pathway in diabetic complications oda05014   Amyotrophic lateral sclerosis oda05022   Pathways of neurodegeneration - multiple diseases oda05132   Salmonella infection oda05145   Toxoplasmosis oda05152   Tuberculosis oda05161   Hepatitis B oda05162   Measles oda05168   Herpes simplex virus 1 infection oda05169   Epstein-Barr virus infection oda05170   Human immunodeficiency virus 1 infection oda05200   Pathways in cancer oda05206   MicroRNAs in cancer oda05207   Chemical carcinogenesis - receptor activation oda05210   Colorectal cancer oda05215   Prostate cancer oda05222   Small cell lung cancer oda05226   Gastric cancer oda05417   Lipid and atherosclerosis oda05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:oda00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     120880862 (BCL2)  09130 Environmental Information Processing   09132 Signal transduction    04340 Hedgehog signaling pathway     120880862 (BCL2)    04630 JAK-STAT signaling pathway     120880862 (BCL2)    04064 NF-kappa B signaling pathway     120880862 (BCL2)    04066 HIF-1 signaling pathway     120880862 (BCL2)    04071 Sphingolipid signaling pathway     120880862 (BCL2)    04151 PI3K-Akt signaling pathway     120880862 (BCL2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     120880862 (BCL2)   09143 Cell growth and death    04210 Apoptosis     120880862 (BCL2)    04215 Apoptosis - multiple species     120880862 (BCL2)    04217 Necroptosis     120880862 (BCL2)    04115 p53 signaling pathway     120880862 (BCL2)   09144 Cellular community - eukaryotes    04510 Focal adhesion     120880862 (BCL2)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     120880862 (BCL2)   09152 Endocrine system    04915 Estrogen signaling pathway     120880862 (BCL2)    04928 Parathyroid hormone synthesis, secretion and action     120880862 (BCL2)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     120880862 (BCL2)   09156 Nervous system    04725 Cholinergic synapse     120880862 (BCL2)    04722 Neurotrophin signaling pathway     120880862 (BCL2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     120880862 (BCL2)    05206 MicroRNAs in cancer     120880862 (BCL2)    05207 Chemical carcinogenesis - receptor activation     120880862 (BCL2)   09162 Cancer: specific types    05210 Colorectal cancer     120880862 (BCL2)    05226 Gastric cancer     120880862 (BCL2)    05215 Prostate cancer     120880862 (BCL2)    05222 Small cell lung cancer     120880862 (BCL2)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     120880862 (BCL2)    05161 Hepatitis B     120880862 (BCL2)    05162 Measles     120880862 (BCL2)    05168 Herpes simplex virus 1 infection     120880862 (BCL2)    05169 Epstein-Barr virus infection     120880862 (BCL2)   09171 Infectious disease: bacterial    05132 Salmonella infection     120880862 (BCL2)    05152 Tuberculosis     120880862 (BCL2)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     120880862 (BCL2)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     120880862 (BCL2)    05022 Pathways of neurodegeneration - multiple diseases     120880862 (BCL2)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     120880862 (BCL2)    05418 Fluid shear stress and atherosclerosis     120880862 (BCL2)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     120880862 (BCL2)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     120880862 (BCL2)    01524 Platinum drug resistance     120880862 (BCL2)    01522 Endocrine resistance     120880862 (BCL2)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:oda01009]     120880862 (BCL2) Protein phosphatases and associated proteins [BR:oda01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      120880862 (BCL2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  120880862 NCBI-ProteinID:  XP_040120197 LinkDB All DBs Position Unknown AA seq 230 aa AA seqDB search MAHAGGAGYDNREIVLKFIHYKLSQRGYEWDAGAAGAAPPGAAPAPGILSSQPGRTPAPS RTSPPPPPAAAAAGPAPSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGR FATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDSIALWMTEYLNRHLHTWI QDNGGWDAFVELYGPSMRPLFDFSWLSLKALLSLALVGACITLGAYLGHK NT seq 693 nt NT seq  +upstreamnt  +downstreamnt atggcgcacgcggggggagcaggctacgataaccgagagatcgtgctcaagttcatccac tacaagctgtcgcagcggggctacgagtgggatgccggggccgcgggcgccgcgcccccc ggggccgcccccgcgccgggcatcctgtcctcccagccgggccgcacgcccgcgccctcc aggacctccccgccgccgcccccggccgccgccgccgccgggcctgcgcccagcccggtg ccacctgtggtccacctgaccctgcgccaggccggcgatgacttctctcggcgctaccgc cgcgacttcgccgagatgtccagccagctgcacctgacgcccttcaccgcgaggggacgc ttcgccacggtggtggaggagctcttcagggacggggtgaactgggggcgcatcgtggcc ttctttgagttcggaggggtcatgtgtgtggagagcgtcaaccgggagatgtcgccgctg gtggacagcatcgccctgtggatgaccgagtacctgaaccggcatctgcacacctggatc caggacaacggaggctgggacgcctttgtggagctgtatggccctagtatgcggcccctg tttgatttctcctggctgtctctgaaggcactgctcagtctggccctggtgggcgcttgc atcaccctgggcgcctatctgggccataagtga

DBGET integrated database retrieval system