Ostrinia furnacalis (Asian corn borer): 114354106 Help Entry 114354106         CDS       T07986                                  Name (RefSeq) GTP-binding nuclear protein Ran   KO K07936   GTP-binding nuclear protein Ran Organism ofu  Ostrinia furnacalis (Asian corn borer) Pathway ofu03008   Ribosome biogenesis in eukaryotes ofu03013   Nucleocytoplasmic transport ofu03250   Viral life cycle - HIV-1 Brite KEGG Orthology (KO) [BR:ofu00001]  09120 Genetic Information Processing   09122 Translation    03013 Nucleocytoplasmic transport     114354106    03008 Ribosome biogenesis in eukaryotes     114354106   09125 Information processing in viruses    03250 Viral life cycle - HIV-1     114354106  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:ofu03019]     114354106    03009 Ribosome biogenesis [BR:ofu03009]     114354106    03016 Transfer RNA biogenesis [BR:ofu03016]     114354106    03036 Chromosome and associated proteins [BR:ofu03036]     114354106   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ofu04147]     114354106    04031 GTP-binding proteins [BR:ofu04031]     114354106 Messenger RNA biogenesis [BR:ofu03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     Ran-mediated transport factors      114354106 Ribosome biogenesis [BR:ofu03009]  Eukaryotic type   Pre-40S particles    Export and cytoplasmic maturation factors     114354106   Pre-60S particles     114354106 Transfer RNA biogenesis [BR:ofu03016]  Eukaryotic type   tRNA transport factors    tRNA export factors     114354106 Chromosome and associated proteins [BR:ofu03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Regulators of centriole replication      114354106    Spindle formation proteins     114354106 Exosome [BR:ofu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    114354106 GTP-binding proteins [BR:ofu04031]  Small (monomeric) G-proteins   Ran Family    Ran     114354106 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RNA_helicase AAA_24 Gtr1_RagA ArgoMid AAA_16 AAA_7 DUF5906 AAA_22 Motif Other DBs NCBI-GeneID:  114354106 NCBI-ProteinID:  XP_028162165 LinkDB All DBs Position Unknown AA seq 213 aa AA seqDB search MTDDMPTFKCVLVGDGGTGKTTFVKRHLTGEFEKRYVATLGVEVHPLVFHTNRGPIRFNV WDTAGQEKFGGLRDGYYIQGQCAIIMFDVTSRVTYKNVPNWHRDLVRVCEGIPIVLCGNK VDIKDRKVKAKTIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDGNLEFVAMPALV PPEVTMDPQWQNQIEKDLKEAQDTALPEEDEDL NT seq 642 nt NT seq  +upstreamnt  +downstreamnt atgactgatgatatgcccacattcaaatgcgtgctggtaggcgacggtggtactggcaaa actacatttgtgaaacggcacttgactggagagttcgagaaaagatatgtcgccacattg ggtgttgaagtacatccgctagttttccatacaaatcgaggaccgatcagatttaacgtt tgggatacggccggtcaagaaaaattcggtggtcttcgagatggttattatatccaaggt caatgcgccatcatcatgttcgacgtaacctcccgagttacctacaaaaatgtaccaaac tggcacagagacttggtgcgcgtctgtgaaggtattcccattgtgctgtgtggtaacaaa gttgacatcaaggacagaaaagtcaaagcgaaaacaatcgttttccacaggaaaaagaat cttcagtattatgacatttctgccaagtcaaactacaacttcgagaagcccttcctttgg ttagctagaaagttaattggtgatggcaacttggaatttgttgctatgcccgccttggtc cccccagaagtcaccatggaccctcaatggcagaaccaaatcgagaaagatctcaaggaa gcccaagatactgctctaccagaagaggatgaagacttgtaa

DBGET integrated database retrieval system