Otolemur garnettii (small-eared galago): 100941255 Help Entry 100941255         CDS       T07855                                  Symbol PLA2G1B Name (RefSeq) phospholipase A2   KO K01047   secretory phospholipase A2 [EC:3.1.1.4] Organism oga  Otolemur garnettii (small-eared galago) Pathway oga00564   Glycerophospholipid metabolism oga00565   Ether lipid metabolism oga00590   Arachidonic acid metabolism oga00591   Linoleic acid metabolism oga00592   alpha-Linolenic acid metabolism oga01100   Metabolic pathways oga04014   Ras signaling pathway oga04270   Vascular smooth muscle contraction oga04972   Pancreatic secretion oga04975   Fat digestion and absorption Brite KEGG Orthology (KO) [BR:oga00001]  09100 Metabolism   09103 Lipid metabolism    00564 Glycerophospholipid metabolism     100941255 (PLA2G1B)    00565 Ether lipid metabolism     100941255 (PLA2G1B)    00590 Arachidonic acid metabolism     100941255 (PLA2G1B)    00591 Linoleic acid metabolism     100941255 (PLA2G1B)    00592 alpha-Linolenic acid metabolism     100941255 (PLA2G1B)  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     100941255 (PLA2G1B)  09150 Organismal Systems   09153 Circulatory system    04270 Vascular smooth muscle contraction     100941255 (PLA2G1B)   09154 Digestive system    04972 Pancreatic secretion     100941255 (PLA2G1B)    04975 Fat digestion and absorption     100941255 (PLA2G1B)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:oga03036]     100941255 (PLA2G1B) Enzymes [BR:oga01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.1  Carboxylic-ester hydrolases     3.1.1.4  phospholipase A2      100941255 (PLA2G1B) Chromosome and associated proteins [BR:oga03036]  Eukaryotic type   Centrosome formation proteins    Centriole proteins     100941255 (PLA2G1B) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Phospholip_A2_1 Motif Other DBs NCBI-GeneID:  100941255 NCBI-ProteinID:  XP_012660656 LinkDB All DBs Position Unknown AA seq 106 aa AA seqDB search MKLLVLAALLTVGGAHSISPRAVWQFRNMIKCTIPESDPLKDYNNYGCYCGLGGSGTPVD ELDTLPSKNKDCQAFICNCDRNAAICFSKAPYNADNKNLNSKFCKN NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgaaactccttgtgctggctgctctgctcacagtgggaggtgcccacagcatcagccca cgggccgtgtggcagttccgaaacatgatcaagtgcacgatccccgagagtgaccccttg aaggattacaataactacggttgctactgcggcttaggtggctcgggcacccctgtggat gagttggacaccctcccaagcaagaacaaagactgccaggccttcatttgcaactgtgac cgcaatgctgccatatgcttttcaaaggctccatacaacgcagataacaaaaacctgaac agcaagttttgtaagaattaa

DBGET integrated database retrieval system