Otolemur garnettii (small-eared galago): 100942631 Help Entry 100942631         CDS       T07855                                  Symbol FGF2 Name (RefSeq) fibroblast growth factor 2   KO K18497   fibroblast growth factor 2 Organism oga  Otolemur garnettii (small-eared galago) Pathway oga01521   EGFR tyrosine kinase inhibitor resistance oga04010   MAPK signaling pathway oga04014   Ras signaling pathway oga04015   Rap1 signaling pathway oga04020   Calcium signaling pathway oga04151   PI3K-Akt signaling pathway oga04550   Signaling pathways regulating pluripotency of stem cells oga04810   Regulation of actin cytoskeleton oga05167   Kaposi sarcoma-associated herpesvirus infection oga05200   Pathways in cancer oga05205   Proteoglycans in cancer oga05207   Chemical carcinogenesis - receptor activation oga05218   Melanoma oga05224   Breast cancer oga05226   Gastric cancer Brite KEGG Orthology (KO) [BR:oga00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100942631 (FGF2)    04014 Ras signaling pathway     100942631 (FGF2)    04015 Rap1 signaling pathway     100942631 (FGF2)    04020 Calcium signaling pathway     100942631 (FGF2)    04151 PI3K-Akt signaling pathway     100942631 (FGF2)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04550 Signaling pathways regulating pluripotency of stem cells     100942631 (FGF2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     100942631 (FGF2)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100942631 (FGF2)    05205 Proteoglycans in cancer     100942631 (FGF2)    05207 Chemical carcinogenesis - receptor activation     100942631 (FGF2)   09162 Cancer: specific types    05226 Gastric cancer     100942631 (FGF2)    05218 Melanoma     100942631 (FGF2)    05224 Breast cancer     100942631 (FGF2)   09172 Infectious disease: viral    05167 Kaposi sarcoma-associated herpesvirus infection     100942631 (FGF2)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     100942631 (FGF2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oga04052]     100942631 (FGF2)    00536 Glycosaminoglycan binding proteins [BR:oga00536]     100942631 (FGF2) Cytokines and neuropeptides [BR:oga04052]  Cytokines   Growth factors (RTK binding)    100942631 (FGF2) Glycosaminoglycan binding proteins [BR:oga00536]  Heparan sulfate / Heparin   Growth factors/receptors    100942631 (FGF2) SSDB OrthologParalogGFIT Motif Pfam:  FGF Fascin IL1 WD40_RFWD3 Motif Other DBs NCBI-GeneID:  100942631 NCBI-ProteinID:  XP_003795568 LinkDB All DBs Position Unknown AA seq 155 aa AA seqDB search MAAGSITTLPSLPEDGGSDAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPYI KLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKLITDECFFFERLESNNYNTYRSRKY SSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atggcagccgggagcatcaccacgctgccctccctgcccgaggacggcggcagcgacgcc tttccgcccggccacttcaaggaccccaagcgactgtactgcaaaaacgggggcttcttc ctgcgcatccaccccgacggccgagtggacggggtccgggagaagagcgacccttacatc aaactacaacttcaagcagaagagagaggagttgtgtctatcaaaggagtgtgtgcgaac cgttaccttgctatgaaggaagacggaagattgctggcttctaaattgattacagacgag tgcttcttttttgaacgactggaatctaataactacaatacttaccggtcaagaaaatac tccagttggtatgtggcactgaaacgaactggacagtataaacttggatccaaaacagga cctgggcagaaagctatactttttcttccaatgtctgctaagagctga

DBGET integrated database retrieval system