Otolemur garnettii (small-eared galago): 100946548 Help Entry 100946548         CDS       T07855                                  Symbol CXCL12 Name (RefSeq) stromal cell-derived factor 1   KO K10031   C-X-C motif chemokine 12 Organism oga  Otolemur garnettii (small-eared galago) Pathway oga04060   Cytokine-cytokine receptor interaction oga04061   Viral protein interaction with cytokine and cytokine receptor oga04062   Chemokine signaling pathway oga04064   NF-kappa B signaling pathway oga04360   Axon guidance oga04670   Leukocyte transendothelial migration oga04672   Intestinal immune network for IgA production oga04810   Regulation of actin cytoskeleton oga05163   Human cytomegalovirus infection oga05200   Pathways in cancer oga05323   Rheumatoid arthritis Brite KEGG Orthology (KO) [BR:oga00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     100946548 (CXCL12)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100946548 (CXCL12)    04061 Viral protein interaction with cytokine and cytokine receptor     100946548 (CXCL12)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     100946548 (CXCL12)  09150 Organismal Systems   09151 Immune system    04670 Leukocyte transendothelial migration     100946548 (CXCL12)    04672 Intestinal immune network for IgA production     100946548 (CXCL12)    04062 Chemokine signaling pathway     100946548 (CXCL12)   09158 Development and regeneration    04360 Axon guidance     100946548 (CXCL12)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100946548 (CXCL12)   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     100946548 (CXCL12)   09163 Immune disease    05323 Rheumatoid arthritis     100946548 (CXCL12)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oga04052]     100946548 (CXCL12)    00536 Glycosaminoglycan binding proteins [BR:oga00536]     100946548 (CXCL12) Cytokines and neuropeptides [BR:oga04052]  Cytokines   Chemokines    100946548 (CXCL12) Glycosaminoglycan binding proteins [BR:oga00536]  Heparan sulfate / Heparin   Chemokines    100946548 (CXCL12) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  100946548 NCBI-ProteinID:  XP_023372936 LinkDB All DBs Position Unknown AA seq 75 aa AA seqDB search FSLPLLGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDP KLKWIQEYLEKALNK NT seq 228 nt NT seq  +upstreamnt  +downstreamnt ttctccctacctctcctagggaaacccgtcagcctgagctacagatgtccatgccgattc tttgaaagccatgttgccagagccaacgtcaagcatctcaaaatcctcaatactccaaac tgtgcccttcagattgtggcgaggctgaagaacaacaacagacaagtgtgcatcgacccc aaattaaagtggattcaggaatacctggagaaagctttaaacaagtaa

DBGET integrated database retrieval system