Otolemur garnettii (small-eared galago): 100953435 Help Entry 100953435         CDS       T07855                                  Symbol FOS Name (RefSeq) proto-oncogene c-Fos   KO K04379   proto-oncogene protein c-fos Organism oga  Otolemur garnettii (small-eared galago) Pathway oga01522   Endocrine resistance oga04010   MAPK signaling pathway oga04024   cAMP signaling pathway oga04210   Apoptosis oga04380   Osteoclast differentiation oga04620   Toll-like receptor signaling pathway oga04657   IL-17 signaling pathway oga04658   Th1 and Th2 cell differentiation oga04659   Th17 cell differentiation oga04660   T cell receptor signaling pathway oga04662   B cell receptor signaling pathway oga04668   TNF signaling pathway oga04713   Circadian entrainment oga04725   Cholinergic synapse oga04728   Dopaminergic synapse oga04915   Estrogen signaling pathway oga04917   Prolactin signaling pathway oga04921   Oxytocin signaling pathway oga04926   Relaxin signaling pathway oga04928   Parathyroid hormone synthesis, secretion and action oga04932   Non-alcoholic fatty liver disease oga04935   Growth hormone synthesis, secretion and action oga05031   Amphetamine addiction oga05132   Salmonella infection oga05133   Pertussis oga05135   Yersinia infection oga05140   Leishmaniasis oga05142   Chagas disease oga05161   Hepatitis B oga05162   Measles oga05166   Human T-cell leukemia virus 1 infection oga05167   Kaposi sarcoma-associated herpesvirus infection oga05170   Human immunodeficiency virus 1 infection oga05171   Coronavirus disease - COVID-19 oga05200   Pathways in cancer oga05207   Chemical carcinogenesis - receptor activation oga05208   Chemical carcinogenesis - reactive oxygen species oga05210   Colorectal cancer oga05224   Breast cancer oga05231   Choline metabolism in cancer oga05235   PD-L1 expression and PD-1 checkpoint pathway in cancer oga05323   Rheumatoid arthritis oga05417   Lipid and atherosclerosis oga05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:oga00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100953435 (FOS)    04668 TNF signaling pathway     100953435 (FOS)    04024 cAMP signaling pathway     100953435 (FOS)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     100953435 (FOS)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100953435 (FOS)    04660 T cell receptor signaling pathway     100953435 (FOS)    04658 Th1 and Th2 cell differentiation     100953435 (FOS)    04659 Th17 cell differentiation     100953435 (FOS)    04657 IL-17 signaling pathway     100953435 (FOS)    04662 B cell receptor signaling pathway     100953435 (FOS)   09152 Endocrine system    04915 Estrogen signaling pathway     100953435 (FOS)    04917 Prolactin signaling pathway     100953435 (FOS)    04921 Oxytocin signaling pathway     100953435 (FOS)    04926 Relaxin signaling pathway     100953435 (FOS)    04935 Growth hormone synthesis, secretion and action     100953435 (FOS)    04928 Parathyroid hormone synthesis, secretion and action     100953435 (FOS)   09156 Nervous system    04725 Cholinergic synapse     100953435 (FOS)    04728 Dopaminergic synapse     100953435 (FOS)   09158 Development and regeneration    04380 Osteoclast differentiation     100953435 (FOS)   09159 Environmental adaptation    04713 Circadian entrainment     100953435 (FOS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100953435 (FOS)    05207 Chemical carcinogenesis - receptor activation     100953435 (FOS)    05208 Chemical carcinogenesis - reactive oxygen species     100953435 (FOS)    05231 Choline metabolism in cancer     100953435 (FOS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     100953435 (FOS)   09162 Cancer: specific types    05210 Colorectal cancer     100953435 (FOS)    05224 Breast cancer     100953435 (FOS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100953435 (FOS)    05170 Human immunodeficiency virus 1 infection     100953435 (FOS)    05161 Hepatitis B     100953435 (FOS)    05171 Coronavirus disease - COVID-19     100953435 (FOS)    05162 Measles     100953435 (FOS)    05167 Kaposi sarcoma-associated herpesvirus infection     100953435 (FOS)   09171 Infectious disease: bacterial    05132 Salmonella infection     100953435 (FOS)    05135 Yersinia infection     100953435 (FOS)    05133 Pertussis     100953435 (FOS)   09174 Infectious disease: parasitic    05140 Leishmaniasis     100953435 (FOS)    05142 Chagas disease     100953435 (FOS)   09163 Immune disease    05323 Rheumatoid arthritis     100953435 (FOS)   09165 Substance dependence    05031 Amphetamine addiction     100953435 (FOS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100953435 (FOS)    05418 Fluid shear stress and atherosclerosis     100953435 (FOS)   09167 Endocrine and metabolic disease    04932 Non-alcoholic fatty liver disease     100953435 (FOS)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     100953435 (FOS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:oga03000]     100953435 (FOS)    04131 Membrane trafficking [BR:oga04131]     100953435 (FOS) Transcription factors [BR:oga03000]  Eukaryotic type   Basic leucine zipper (bZIP)    AP-1(-like) components, Fos     100953435 (FOS) Membrane trafficking [BR:oga04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     100953435 (FOS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  bZIP_1 bZIP_2 bZIP_Maf MIC19_MIC25 DUF3450 HALZ Macoilin Motif Other DBs NCBI-GeneID:  100953435 NCBI-ProteinID:  XP_003786970 Ensembl:  ENSOGAG00000032356 UniProt:  H0XNH1 LinkDB All DBs Position Unknown AA seq 380 aa AA seqDB search MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLSVSSANF IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGVPTPSAGAYSRTGVVKNMTGGRA QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLSVGLPEAATPESEEAFT LPLLNDPEPKPPVQPVKNISSMELKAEPFDDFLFPASSRPSGSETARSVPDMDMSGSFYA ADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTTYTSSFVFTYPESDSFPSCAAAHRK GSSSNEPSSDSLSSPTLLAL NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt atgatgttctcgggcttcaacgccgactacgaggcttcatcctcccgctgcagcagcgct tccccggccggggacagtctctcctactaccattcaccggccgactccttctccagcatg ggctctccggttaacgcacaggacttctgcaccgacctgtccgtctctagtgccaacttc atccccacagtgactgccatctctaccagtccggacctgcagtggctggtgcagcccact ctggtctcctccgtggctccatcgcagaccagagccccccacccttacggagtccccact ccctcagccggggcttactctaggactggagtcgtaaagaacatgactggaggcagagca cagagcattggcaggaggggcaaggtggaacagctatcacctgaagaagaagagaaaagg agaatccgaagggaaagaaataagatggctgcagccaaatgccgtaaccggaggagggag ctgactgatacactccaagcggagacagatcaactagaggatgagaagtccgctttgcag actgagattgccaacctgctgaaggagaaggagaaacttgagttcatcctggcagctcac cggcctgcctgcaagatccctgatgacctgggcttcccagaagagatgtcagtggcttcc cttgatctgagtgtgggcctgccagaggctgccactccggagtctgaggaggccttcacc ctgccactcctcaatgaccctgagcctaagcccccggtgcagccagtcaagaacatcagc agcatggagctaaaggctgagccctttgatgacttcctgttcccagcatcatccaggccc agcggctctgagacagcccgctctgtgccagacatggacatgtctggttccttctatgca gcagactgggagcccctgcacagtggctccctggggatggggcccatggccacagagctg gagcccctgtgcaccccagtggtcacctgcactcccagctgcaccacttatacgtcttcc ttcgtcttcacctacccggagtctgactccttccccagctgcgcggctgcccaccgcaag ggcagcagcagcaatgagccctcctctgactcgctcagctcacccacgctgctggccctg tga

DBGET integrated database retrieval system