Otolemur garnettii (small-eared galago): 100959385 Help Entry 100959385         CDS       T07855                                  Symbol IFNB1 Name (RefSeq) interferon beta   KO K05415   interferon beta Organism oga  Otolemur garnettii (small-eared galago) Pathway oga04060   Cytokine-cytokine receptor interaction oga04151   PI3K-Akt signaling pathway oga04217   Necroptosis oga04380   Osteoclast differentiation oga04620   Toll-like receptor signaling pathway oga04621   NOD-like receptor signaling pathway oga04622   RIG-I-like receptor signaling pathway oga04623   Cytosolic DNA-sensing pathway oga04630   JAK-STAT signaling pathway oga04650   Natural killer cell mediated cytotoxicity oga04668   TNF signaling pathway oga04936   Alcoholic liver disease oga05135   Yersinia infection oga05142   Chagas disease oga05152   Tuberculosis oga05160   Hepatitis C oga05161   Hepatitis B oga05162   Measles oga05163   Human cytomegalovirus infection oga05164   Influenza A oga05165   Human papillomavirus infection oga05167   Kaposi sarcoma-associated herpesvirus infection oga05168   Herpes simplex virus 1 infection oga05169   Epstein-Barr virus infection oga05170   Human immunodeficiency virus 1 infection oga05171   Coronavirus disease - COVID-19 oga05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:oga00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100959385 (IFNB1)    04668 TNF signaling pathway     100959385 (IFNB1)    04151 PI3K-Akt signaling pathway     100959385 (IFNB1)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100959385 (IFNB1)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     100959385 (IFNB1)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100959385 (IFNB1)    04621 NOD-like receptor signaling pathway     100959385 (IFNB1)    04622 RIG-I-like receptor signaling pathway     100959385 (IFNB1)    04623 Cytosolic DNA-sensing pathway     100959385 (IFNB1)    04650 Natural killer cell mediated cytotoxicity     100959385 (IFNB1)   09158 Development and regeneration    04380 Osteoclast differentiation     100959385 (IFNB1)  09160 Human Diseases   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     100959385 (IFNB1)    05161 Hepatitis B     100959385 (IFNB1)    05160 Hepatitis C     100959385 (IFNB1)    05171 Coronavirus disease - COVID-19     100959385 (IFNB1)    05164 Influenza A     100959385 (IFNB1)    05162 Measles     100959385 (IFNB1)    05168 Herpes simplex virus 1 infection     100959385 (IFNB1)    05163 Human cytomegalovirus infection     100959385 (IFNB1)    05167 Kaposi sarcoma-associated herpesvirus infection     100959385 (IFNB1)    05169 Epstein-Barr virus infection     100959385 (IFNB1)    05165 Human papillomavirus infection     100959385 (IFNB1)   09171 Infectious disease: bacterial    05135 Yersinia infection     100959385 (IFNB1)    05152 Tuberculosis     100959385 (IFNB1)   09174 Infectious disease: parasitic    05142 Chagas disease     100959385 (IFNB1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100959385 (IFNB1)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     100959385 (IFNB1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oga04052]     100959385 (IFNB1) Cytokines and neuropeptides [BR:oga04052]  Cytokines   Interferons    100959385 (IFNB1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Interferon KAR9 TMEM127 Motif Other DBs NCBI-GeneID:  100959385 NCBI-ProteinID:  XP_003782906 Ensembl:  ENSOGAG00000007828 UniProt:  H0XKS8 LinkDB All DBs Position Unknown AA seq 187 aa AA seqDB search MTNKCILQVILLLCFLTMASSTSSSLLQFQQRRSTLGCQKLLRQLNGKPEGCLKDRMNFE IPKEIKQPQHLQKEDAMLFIYEMLQNIFRILRRDFSSTGWNETIVDALLANFHQQMDSLE TTLDEKLEDKNFIGGKVTNILHLKSYYFRITWYLKAKRYSSCAWTVVREEILRNLFFINR LTGYLKN NT seq 564 nt NT seq  +upstreamnt  +downstreamnt atgaccaacaagtgcatcctccaagtcatcctcctgctgtgcttcctcactatggcttct tccaccagctccagcttgcttcagttccaacagagaagaagtaccttggggtgtcagaag ctcctgcggcaattgaatgggaagcctgaaggttgcctcaaggacaggatgaactttgag atccctaaggagatcaagcagccacagcatctccagaaggaggacgccatgttgttcatc tatgagatgctccagaacatcttcagaattttgagaagagatttctctagcactggctgg aatgagaccattgtagatgctctccttgctaacttccatcagcagatggactctctggag acaaccctggacgaaaaactagaggacaaaaacttcatcgggggaaaagtcacaaacatt ctgcacctgaagagttattacttcaggatcacgtggtacctgaaggccaagaggtacagc agctgtgcctggacagttgtccgagaggaaatcctcaggaacctcttcttcattaacaga ctaacaggatacctgaaaaactga

DBGET integrated database retrieval system