Otolemur garnettii (small-eared galago): 100960589 Help Entry 100960589         CDS       T07855                                  Symbol CDK4 Name (RefSeq) cyclin-dependent kinase 4   KO K02089   cyclin-dependent kinase 4 [EC:2.7.11.22] Organism oga  Otolemur garnettii (small-eared galago) Pathway oga01522   Endocrine resistance oga04110   Cell cycle oga04115   p53 signaling pathway oga04151   PI3K-Akt signaling pathway oga04218   Cellular senescence oga04530   Tight junction oga04660   T cell receptor signaling pathway oga04933   AGE-RAGE signaling pathway in diabetic complications oga04934   Cushing syndrome oga05160   Hepatitis C oga05162   Measles oga05163   Human cytomegalovirus infection oga05164   Influenza A oga05165   Human papillomavirus infection oga05166   Human T-cell leukemia virus 1 infection oga05167   Kaposi sarcoma-associated herpesvirus infection oga05169   Epstein-Barr virus infection oga05200   Pathways in cancer oga05203   Viral carcinogenesis oga05212   Pancreatic cancer oga05214   Glioma oga05218   Melanoma oga05219   Bladder cancer oga05220   Chronic myeloid leukemia oga05222   Small cell lung cancer oga05223   Non-small cell lung cancer oga05224   Breast cancer oga05225   Hepatocellular carcinoma Brite KEGG Orthology (KO) [BR:oga00001]  09130 Environmental Information Processing   09132 Signal transduction    04151 PI3K-Akt signaling pathway     100960589 (CDK4)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     100960589 (CDK4)    04115 p53 signaling pathway     100960589 (CDK4)    04218 Cellular senescence     100960589 (CDK4)   09144 Cellular community - eukaryotes    04530 Tight junction     100960589 (CDK4)  09150 Organismal Systems   09151 Immune system    04660 T cell receptor signaling pathway     100960589 (CDK4)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100960589 (CDK4)    05203 Viral carcinogenesis     100960589 (CDK4)   09162 Cancer: specific types    05212 Pancreatic cancer     100960589 (CDK4)    05225 Hepatocellular carcinoma     100960589 (CDK4)    05214 Glioma     100960589 (CDK4)    05220 Chronic myeloid leukemia     100960589 (CDK4)    05218 Melanoma     100960589 (CDK4)    05219 Bladder cancer     100960589 (CDK4)    05224 Breast cancer     100960589 (CDK4)    05222 Small cell lung cancer     100960589 (CDK4)    05223 Non-small cell lung cancer     100960589 (CDK4)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     100960589 (CDK4)    05160 Hepatitis C     100960589 (CDK4)    05164 Influenza A     100960589 (CDK4)    05162 Measles     100960589 (CDK4)    05163 Human cytomegalovirus infection     100960589 (CDK4)    05167 Kaposi sarcoma-associated herpesvirus infection     100960589 (CDK4)    05169 Epstein-Barr virus infection     100960589 (CDK4)    05165 Human papillomavirus infection     100960589 (CDK4)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     100960589 (CDK4)    04934 Cushing syndrome     100960589 (CDK4)   09176 Drug resistance: antineoplastic    01522 Endocrine resistance     100960589 (CDK4)  09180 Brite Hierarchies   09181 Protein families: metabolism    01001 Protein kinases [BR:oga01001]     100960589 (CDK4) Enzymes [BR:oga01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.11  Protein-serine/threonine kinases     2.7.11.22  cyclin-dependent kinase      100960589 (CDK4) Protein kinases [BR:oga01001]  Serine/threonine kinases: CMGC group   CDK family    100960589 (CDK4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Pkinase PK_Tyr_Ser-Thr APH Kdo ABC1 Haspin_kinase Kinase-like Motif Other DBs NCBI-GeneID:  100960589 NCBI-ProteinID:  XP_003790635 Ensembl:  ENSOGAG00000014371 LinkDB All DBs Position Unknown AA seq 305 aa AA seqDB search MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGAGGGLPISTVREVALL RRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDL MRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWY RAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPR DVSLPRGAFPPRGPRPVQSVVPELEESGAQLLLEMLTFNPHKRISAFRALQHSYLQKDEG NPSEQ NT seq 918 nt NT seq  +upstreamnt  +downstreamnt atggctacctctcggtatgagccagtggctgaaattggtgtcggtgcctatgggacagtg tacaaggcccgtgatccccacagtggccactttgtggccctcaagagtgtaagagtgccc aatggaggaggagctggagggggccttcccatcagcacagttcgagaggtggccttacta aggcggctggaggcttttgagcaccccaatgttgttcggctcatggacgtctgtgccaca tcccgaactgaccgggagattaaagtcaccctggtgtttgagcatgtagaccaagaccta agaacttatctggacaaggcacccccaccaggcttgccagctgagaccatcaaggatctg atgcgacaatttctaagaggccttgatttcctgcatgctaattgcattgttcatcgagat ctgaagccagagaatattctggtgacaagtggtgggacagtcaagctggctgactttggc ctggctagaatctacagctaccagatggcacttacacctgtggttgttaccctctggtac cgagctccagaagttctcttgcagtctacatatgcaacacctgtggacatgtggagcgtt ggctgtatttttgcagagatgtttcgtcgaaagcctctcttctgtggaaactctgaagct gaccagttgggcaaaatctttgacctgatagggctgcctccagaggatgactggcccagg gatgtctctctaccccgaggagcctttcctccaagagggccccgcccagtgcagtcagtg gtgcctgagctggaggagtctggagcacagctgctgctggaaatgctgacttttaaccca cacaagcgaatttctgccttccgagctctgcagcattcttatcttcagaaggatgaaggt aatccaagtgagcaatag

DBGET integrated database retrieval system