Otolemur garnettii (small-eared galago): 100961297 Help Entry 100961297         CDS       T07855                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism oga  Otolemur garnettii (small-eared galago) Pathway oga00510   N-Glycan biosynthesis oga00513   Various types of N-glycan biosynthesis oga04141   Protein processing in endoplasmic reticulum Module oga_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:oga00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     100961297    00513 Various types of N-glycan biosynthesis     100961297  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     100961297 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ost5 DUF6512 TctB Phage_holin_3_3 Motif Other DBs NCBI-GeneID:  100961297 NCBI-ProteinID:  XP_012658757 Ensembl:  ENSOGAG00000025870 LinkDB All DBs Position Unknown AA seq 79 aa AA seqDB search MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVA SLFMGFGVLFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagctcgaggccatgagcagatataccagcccagtgaacccagctgtcttccctcat ctgactgtggtacttttggccattggcatgttcttcaccgcctggttcttcgtctatgag gtcacttctaccaagtacactcgagatatctacaaagagcttctcatctccttggtggcc tcgctctttatgggctttggagtcctcttcttgctgctctgggtcggcatctacgtgtga

DBGET integrated database retrieval system