Otolemur garnettii (small-eared galago): 100966429 Help Entry 100966429         CDS       T07855                                  Name (RefSeq) actin, cytoplasmic 1-like   KO K05692   actin beta/gamma 1 Organism oga  Otolemur garnettii (small-eared galago) Pathway oga03082   ATP-dependent chromatin remodeling oga04015   Rap1 signaling pathway oga04145   Phagosome oga04210   Apoptosis oga04390   Hippo signaling pathway oga04510   Focal adhesion oga04520   Adherens junction oga04530   Tight junction oga04611   Platelet activation oga04613   Neutrophil extracellular trap formation oga04670   Leukocyte transendothelial migration oga04714   Thermogenesis oga04810   Regulation of actin cytoskeleton oga04814   Motor proteins oga04820   Cytoskeleton in muscle cells oga04919   Thyroid hormone signaling pathway oga04921   Oxytocin signaling pathway oga04971   Gastric acid secretion oga05014   Amyotrophic lateral sclerosis oga05100   Bacterial invasion of epithelial cells oga05132   Salmonella infection oga05135   Yersinia infection oga05164   Influenza A oga05205   Proteoglycans in cancer oga05225   Hepatocellular carcinoma oga05410   Hypertrophic cardiomyopathy oga05412   Arrhythmogenic right ventricular cardiomyopathy oga05414   Dilated cardiomyopathy oga05416   Viral myocarditis oga05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:oga00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     100966429  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     100966429    04390 Hippo signaling pathway     100966429  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     100966429   09143 Cell growth and death    04210 Apoptosis     100966429   09144 Cellular community - eukaryotes    04510 Focal adhesion     100966429    04520 Adherens junction     100966429    04530 Tight junction     100966429   09142 Cell motility    04814 Motor proteins     100966429    04820 Cytoskeleton in muscle cells     100966429    04810 Regulation of actin cytoskeleton     100966429  09150 Organismal Systems   09151 Immune system    04611 Platelet activation     100966429    04613 Neutrophil extracellular trap formation     100966429    04670 Leukocyte transendothelial migration     100966429   09152 Endocrine system    04921 Oxytocin signaling pathway     100966429    04919 Thyroid hormone signaling pathway     100966429   09154 Digestive system    04971 Gastric acid secretion     100966429   09159 Environmental adaptation    04714 Thermogenesis     100966429  09160 Human Diseases   09161 Cancer: overview    05205 Proteoglycans in cancer     100966429   09162 Cancer: specific types    05225 Hepatocellular carcinoma     100966429   09172 Infectious disease: viral    05164 Influenza A     100966429   09171 Infectious disease: bacterial    05132 Salmonella infection     100966429    05135 Yersinia infection     100966429    05100 Bacterial invasion of epithelial cells     100966429   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     100966429   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     100966429    05410 Hypertrophic cardiomyopathy     100966429    05412 Arrhythmogenic right ventricular cardiomyopathy     100966429    05414 Dilated cardiomyopathy     100966429    05416 Viral myocarditis     100966429  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:oga03021]     100966429    03019 Messenger RNA biogenesis [BR:oga03019]     100966429    03036 Chromosome and associated proteins [BR:oga03036]     100966429    03029 Mitochondrial biogenesis [BR:oga03029]     100966429   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:oga04812]     100966429    04147 Exosome [BR:oga04147]     100966429 Transcription machinery [BR:oga03021]  Eukaryotic type   RNA polymerase II system    Coactivators     BAF/PBAF complex      100966429 Messenger RNA biogenesis [BR:oga03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      100966429 Chromosome and associated proteins [BR:oga03036]  Eukaryotic type   Histone modification proteins    HAT complexes     TIP60 complex      100966429     NuA4 complex      100966429   Chromatin remodeling factors    BAF complex     100966429    PBAF complex     100966429    GBAF(ncBAF) complex     100966429    SWR1 complex     100966429 Mitochondrial biogenesis [BR:oga03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Actin cytoskeleton organization     100966429 Cytoskeleton proteins [BR:oga04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actins     Actins      100966429 Exosome [BR:oga04147]  Exosomal proteins   Proteins found in most exosomes    100966429 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Actin Motif Other DBs NCBI-GeneID:  100966429 NCBI-ProteinID:  XP_012658062 Ensembl:  ENSOGAG00000032359 UniProt:  H0XLL5 LinkDB All DBs Position Unknown AA seq 375 aa AA seqDB search MDDDIAALVVDNGSGMCKAGFAGDSAPWAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT QIMFETFNTPAMYVPIQAVLSLYASGRTTGTVMDSGDGVTHTVPIYEGYALPHAILRLDL AGRDLTDYLMKILTQRGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSY ELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLS GGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQKMWISKQ EYDESGPSIVHRKCF NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt atggatgacgatattgctgcgctggtcgttgacaacggctctggcatgtgcaaggccggt ttcgcaggcgacagtgccccttgggctgtcttcccttccatcgtcgggcgcccgcggcac cagggtgtgatggtgggcatgggtcagaaggactcgtacgtgggcgatgaggcccagagc aagagaggcatcctgaccctgaagtaccccatcgagcatggcatcgtcaccaactgggac gacatggagaaaatttggcaccacactttctacaatgagctgcgtgtggcccctgaggag caccctgtgctgctgactgaagcccccctgaaccccaaggctaaccgtgagaagatgacc cagatcatgtttgagaccttcaacactccagccatgtatgtgcccatccaggctgtgctg tccctgtatgcctctggccgtaccactggcaccgtgatggactctggtgatggggtcacc cacactgtgcccatctatgaggggtatgccctccctcatgccatcctgcgtctggacttg gctggccgggacctgacagactacctcatgaagatcctcacccagcgtggctacagcttc accaccacagctgagcgggaaattgtgcgtgacatcaaggagaagctgtgttacgtcgcc ctggacttcgagcaggagatggccacagcagcctccagctcctccctggagaagagctac gagctgcccgatggccaggtgatcaccattggaaatgagcggttccgctgcccagaggct ctgttccagccttccttcctgggcatggaatcctgtggcatccatgaaactaccttcaac tccattatgaagtgtgatgtggacatccgcaaggacctgtatgccaacacagtgctgtca ggtggcaccaccatgtaccctggcatcgccgacagaatgcagaaggagatcactgccctg gctcccagcacaatgaagatcaagatcattgctccccctgagcgcaagtactccgtgtgg atcggaggctccatcctggcctcgctgtccaccttccaaaagatgtggatcagcaagcag gagtatgatgagtctggcccctccattgtccaccgcaaatgcttctag

DBGET integrated database retrieval system