Otolemur garnettii (small-eared galago): 111727809 Help Entry 111727809         CDS       T07855                                  Name (RefSeq) E3 ubiquitin-protein ligase Mdm2   KO K06643   E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27] Organism oga  Otolemur garnettii (small-eared galago) Pathway oga01522   Endocrine resistance oga01524   Platinum drug resistance oga04068   FoxO signaling pathway oga04110   Cell cycle oga04115   p53 signaling pathway oga04120   Ubiquitin mediated proteolysis oga04144   Endocytosis oga04151   PI3K-Akt signaling pathway oga04218   Cellular senescence oga04625   C-type lectin receptor signaling pathway oga04919   Thyroid hormone signaling pathway oga05163   Human cytomegalovirus infection oga05165   Human papillomavirus infection oga05169   Epstein-Barr virus infection oga05200   Pathways in cancer oga05202   Transcriptional misregulation in cancer oga05203   Viral carcinogenesis oga05205   Proteoglycans in cancer oga05206   MicroRNAs in cancer oga05214   Glioma oga05215   Prostate cancer oga05218   Melanoma oga05219   Bladder cancer oga05220   Chronic myeloid leukemia Brite KEGG Orthology (KO) [BR:oga00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     111727809  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     111727809    04151 PI3K-Akt signaling pathway     111727809  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     111727809   09143 Cell growth and death    04110 Cell cycle     111727809    04115 p53 signaling pathway     111727809    04218 Cellular senescence     111727809  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     111727809   09152 Endocrine system    04919 Thyroid hormone signaling pathway     111727809  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     111727809    05202 Transcriptional misregulation in cancer     111727809    05206 MicroRNAs in cancer     111727809    05205 Proteoglycans in cancer     111727809    05203 Viral carcinogenesis     111727809   09162 Cancer: specific types    05214 Glioma     111727809    05220 Chronic myeloid leukemia     111727809    05218 Melanoma     111727809    05219 Bladder cancer     111727809    05215 Prostate cancer     111727809   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     111727809    05169 Epstein-Barr virus infection     111727809    05165 Human papillomavirus infection     111727809   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     111727809    01522 Endocrine resistance     111727809  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oga04131]     111727809    04121 Ubiquitin system [BR:oga04121]     111727809 Enzymes [BR:oga01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.27  RING-type E3 ubiquitin transferase      111727809 Membrane trafficking [BR:oga04131]  Endocytosis   Clathrin-mediated endocytosis    Ubiquitin E3 ligases     111727809 Ubiquitin system [BR:oga04121]  Ubiquitin ligases (E3)   Single Ring-finger type E3    MDM2/MDM4 proteins     111727809 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  zf-C3HC4_3 Zn_ribbon_RanBP zf-RING_2 zf-FPG_IleRS Motif Other DBs NCBI-GeneID:  111727809 NCBI-ProteinID:  XP_023373698 LinkDB All DBs Position Unknown AA seq 279 aa AA seqDB search ILTQCFFFLQDLDAGVSEHSGDWLDQDSVSDQFSVEFEVESLDSEDYSLSEEGQELSDED DEVYRVTVYQAEESDTDSFEEDPEISLADYWKCTSCNEMNPPLPSHCNRCWTLRENWLPE DKGKDRRDISEKAKLENSAQAEEGFDVPDCKKTTGSDSKESSVEVNDDKITQASQSQDSE DYSQPSTSNSIIYSSQEDVKEFEREETQDKEESLESSFPLSAIEPCVICQGRPKNGCIVH GKTGHLMACFTCAKKLKKRNKPCPVCRQPIQMIVLTYFP NT seq 840 nt NT seq  +upstreamnt  +downstreamnt atattgacacagtgttttttctttcttcaggatcttgatgctggtgtaagtgaacattca ggtgactggttggatcaggattcagtttcagatcagtttagtgtagaatttgaagttgaa tctcttgattcggaagattatagtcttagtgaagaaggacaagaactctcagatgaagat gatgaggtgtatcgagttactgtgtatcaagcagaggagagtgatacagattcatttgaa gaagatcctgaaatttctctagctgactattggaaatgtacttcatgcaatgaaatgaat cctcctcttccatcacattgcaacagatgttggacccttcgtgagaattggcttcctgaa gataaaggaaaagacagaagggatatctctgagaaagccaaactagaaaactcagcacaa gccgaagagggctttgatgttccggattgtaaaaaaactacagggagtgattccaaagag tcatctgtggaggtaaatgatgataaaatcactcaggcctcccagtcacaagacagtgag gactattctcagccatcaacttccaatagcattatttacagcagccaagaagatgtcaaa gagtttgagagggaggaaacccaagacaaagaagagagtttggagtccagctttcccctt agtgccattgaaccttgtgtgatttgccaaggtcgacctaaaaatggttgcattgtccat ggcaaaacaggacatcttatggcatgcttcacgtgtgcaaagaagctgaagaagaggaat aagccctgcccagtgtgcagacagccaatccagatgatcgtgctaacgtacttcccctag

DBGET integrated database retrieval system