Oncorhynchus gorbuscha (pink salmon): 124000287 Help Entry 124000287         CDS       T07892                                  Name (RefSeq) RING-box protein 1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism ogo  Oncorhynchus gorbuscha (pink salmon) Pathway ogo03420   Nucleotide excision repair ogo04110   Cell cycle ogo04114   Oocyte meiosis ogo04120   Ubiquitin mediated proteolysis ogo04141   Protein processing in endoplasmic reticulum ogo04310   Wnt signaling pathway ogo04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:ogo00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     124000287    04120 Ubiquitin mediated proteolysis     124000287   09124 Replication and repair    03420 Nucleotide excision repair     124000287  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     124000287    04350 TGF-beta signaling pathway     124000287  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     124000287    04114 Oocyte meiosis     124000287  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ogo04121]     124000287    03400 DNA repair and recombination proteins [BR:ogo03400]     124000287 Enzymes [BR:ogo01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      124000287 Ubiquitin system [BR:ogo04121]  Ubiquitin ligases (E3)   UBL E3 ligases    124000287   Multi subunit type E3    SCF complex     Ring finger protein      124000287    Cul2 complex      124000287    Cul3 complex      124000287    Cul4 complex      124000287    Cul7 complex      124000287    Cul8 complex      124000287    Cul9 complex      124000287 DNA repair and recombination proteins [BR:ogo03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       124000287     TCR (transcription coupled repair) factors      Cul4-CSA complex       124000287 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  124000287 NCBI-ProteinID:  XP_046162507 LinkDB All DBs Position LG16:19980683..19983647 Genome browser AA seq 108 aa AA seqDB search MAAAMDVDTPSATNSGASKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcggcagcgatggatgttgatacaccaagcgccacgaatagtggagcaagcaagaaa cgttttgaagtgaagaagtggaatgcagtggcactttgggcctgggacattgtggtggac aactgtgccatctgtaggaatcacataatggatctctgcatagagtgccaggctaaccag gcctctgccacatcagaggagtgcaccgtagcctggggagtctgcaatcatgcattccat ttccactgtatctcccgttggttgaagaccaggcaggtgtgccccctagacaacagggag tgggagtttcagaaatatggacactag

DBGET integrated database retrieval system