Oncorhynchus gorbuscha (pink salmon): 124031553 Help Entry 124031553         CDS       T07892                                  Symbol tmem258 Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism ogo  Oncorhynchus gorbuscha (pink salmon) Pathway ogo00510   N-Glycan biosynthesis ogo00513   Various types of N-glycan biosynthesis ogo04141   Protein processing in endoplasmic reticulum Module ogo_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:ogo00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     124031553 (tmem258)    00513 Various types of N-glycan biosynthesis     124031553 (tmem258)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     124031553 (tmem258) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 DUF6512 TctB Phage_holin_3_3 Motif Other DBs NCBI-GeneID:  124031553 NCBI-ProteinID:  XP_046198904 LinkDB All DBs Position LG01:complement(1966829..1969851) Genome browser AA seq 79 aa AA seqDB search MELEAMTRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDVFKELLISLVA SLFMGFGVLFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagctggaggccatgacgagatacaccagtccggtgaacccggcagtcttcccccac ctcactgtggtcctactggctatcggcatgttcttcactgcgtggttcttcgtctacgag gtaacgtccactaaatacaccagagacgtgttcaaagagctgctcatctccctggtggcg tctctcttcatgggcttcggagtgctgtttctgttactgtgggtcggcatctatgtctga

DBGET integrated database retrieval system