Opisthocomus hoazin (hoatzin): 104326589 Help Entry 104326589         CDS       T08436                                  Symbol IL6 Name (RefSeq) interleukin-6   KO K05405   interleukin 6 Organism oha  Opisthocomus hoazin (hoatzin) Pathway oha04060   Cytokine-cytokine receptor interaction oha04068   FoxO signaling pathway oha04218   Cellular senescence oha04620   Toll-like receptor signaling pathway oha04621   NOD-like receptor signaling pathway oha04623   Cytosolic DNA-sensing pathway oha04625   C-type lectin receptor signaling pathway oha04672   Intestinal immune network for IgA production oha05132   Salmonella infection oha05164   Influenza A oha05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:oha00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     104326589 (IL6)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     104326589 (IL6)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     104326589 (IL6)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     104326589 (IL6)    04621 NOD-like receptor signaling pathway     104326589 (IL6)    04623 Cytosolic DNA-sensing pathway     104326589 (IL6)    04625 C-type lectin receptor signaling pathway     104326589 (IL6)    04672 Intestinal immune network for IgA production     104326589 (IL6)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     104326589 (IL6)    05168 Herpes simplex virus 1 infection     104326589 (IL6)   09171 Infectious disease: bacterial    05132 Salmonella infection     104326589 (IL6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:oha04052]     104326589 (IL6) Cytokines and neuropeptides [BR:oha04052]  Cytokines   Interleukins    104326589 (IL6) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL6 IL11 Not3 Motif Other DBs NCBI-GeneID:  104326589 NCBI-ProteinID:  XP_009929691 LinkDB All DBs Position Unknown AA seq 142 aa AA seqDB search MEVDIKTGASQLRRGTDLHAPYKQTPLARADKCLKKISSGLYAFQTYLEYVRDTFTSEKQ NVESLCYATEHLARTLRQMVINPDEVVIPDSATQESLRAKLRSDKAWIEKITTHLILRGF TSFMEKTVRAVRYLKNTRSFSV NT seq 429 nt NT seq  +upstreamnt  +downstreamnt atggaagttgacataaagacgggtgccagccagcttcggcgtggcacagacctccacgct ccgtacaagcagactcccctcgcccgcgctgataaatgcttgaagaaaatctccagcggg ctttacgcatttcagacataccttgaatacgtacgggacactttcaccagcgaaaagcag aacgtcgaatcgctgtgctacgctaccgagcacctggcacgtaccctgaggcagatggtg ataaaccccgacgaagtcgtcatcccagactcagctacccaggaatccctccgcgcaaag ctgaggtccgataaggcctggatagagaaaatcaccacccacctcatcctccgaggcttt acttcatttatggagaaaaccgtgagggctgttcgctatttgaaaaacaccaggagtttc agtgtctga

DBGET integrated database retrieval system