Opisthocomus hoazin (hoatzin): 104334346 Help Entry 104334346         CDS       T08436                                  Name (RefSeq) cystatin-like   KO K13899   cystatin-C Organism oha  Opisthocomus hoazin (hoatzin) Brite KEGG Orthology (KO) [BR:oha00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:oha01002]     104334346   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oha04147]     104334346 Peptidases and inhibitors [BR:oha01002]  Peptidase inhibitors   Family I25: cystatin family    104334346 Exosome [BR:oha04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    104334346 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cystatin Motif Other DBs NCBI-GeneID:  104334346 NCBI-ProteinID:  XP_009938253 LinkDB All DBs Position Unknown AA seq 81 aa AA seqDB search MRNVNSKGKEYSSYLEKWIVSGLKYTIEVEIGRTTCPKPATDLQSCALHEAPQMAKHNIC TFVVYTIPWLNETKLLSTSCK NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgaggaatgtcaacagcaagggcaaggaatacagcagttacctggagaaatggattgtg tctggactcaagtacacgatagaagttgagattggccggacaacttgccccaagccagca actgatctccagagctgcgctttgcatgaggcaccgcagatggcgaagcacaacatttgc acctttgtagtgtacactattccttggctaaacgaaactaaactactgtccactagctgc aagtaa

DBGET integrated database retrieval system