Opisthocomus hoazin (hoatzin): 104335143 Help Entry 104335143         CDS       T08436                                  Name (RefSeq) hepatic lectin-like   KO K06563   C-type lectin domain family 4 member L/M Organism oha  Opisthocomus hoazin (hoatzin) Pathway oha03260   Virion - Human immunodeficiency virus oha03264   Virion - Flavivirus and Alphavirus oha03265   Virion - Ebolavirus, Lyssavirus and Morbillivirus oha03273   Virion - Lassa virus and SFTS virus oha04145   Phagosome oha04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:oha00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03260 Virion - Human immunodeficiency virus     104335143    03264 Virion - Flavivirus and Alphavirus     104335143    03265 Virion - Ebolavirus, Lyssavirus and Morbillivirus     104335143    03273 Virion - Lassa virus and SFTS virus     104335143  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     104335143  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     104335143  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oha04131]     104335143   09183 Protein families: signaling and cellular processes    04054 Pattern recognition receptors [BR:oha04054]     104335143    04090 CD molecules [BR:oha04090]     104335143    04091 Lectins [BR:oha04091]     104335143 Membrane trafficking [BR:oha04131]  Endocytosis   Phagocytosis    C-lectin receptors     104335143 Pattern recognition receptors [BR:oha04054]  Membrane-bound pattern recognition receptors   C-type lectin receptors    104335143 CD molecules [BR:oha04090]  Proteins   104335143 Lectins [BR:oha04091]  C-Type lectins   Asialoglycoprotein and DC receptors    104335143 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Lectin_C Motif Other DBs NCBI-GeneID:  104335143 NCBI-ProteinID:  XP_009939141 LinkDB All DBs Position Unknown AA seq 192 aa AA seqDB search MDEEHLHDDLHVFKDRNFFRQKLRSFFAVYLLLALSFLLTFTLFAVSLSRVSALSSKLNE VQPERKQNFSGRDFLLFPCGPGSREWEYFDGKCYYFSLTRTSWYKARADCEEMHSQLVII NSYAEQSFVMFRTRNERFWIGLTDGNSEGEWEWVDGTDYKSTFTQLPCLRTPVSGSGPGF FTLPWDGRSHEV NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atggatgaggaacatctccatgatgacctccacgttttcaaagacagaaacttcttccgg cagaagctgaggtccttcttcgcggtgtacttgctgctggccctctccttcttgctgacc ttcaccctgttcgccgtctcgctctcccgagtttcagctctttcttctaaactcaacgag gtgcagccggaacggaaacagaacttttctggcagggattttctcctgttcccctgcgga cccggatccagggaatgggaatactttgatgggaaatgttactacttctccctaaccaga acgagctggtacaaggcgagggctgattgcgaagagatgcactcgcagttggtcatcatt aacagctacgccgagcagagttttgtcatgttcaggacaaggaatgagcgtttctggatc gggctgacggacgggaattcggaaggggaatgggaatgggttgatgggaccgactacaaa agcacgttcacgcagctcccctgcctgcgcaccccggtttcgggcagcggaccgggtttc ttcaccctgccctgggacgggcgctcccacgaggtctaa

DBGET integrated database retrieval system