Oncorhynchus keta (chum salmon): 118365448 Help Entry 118365448         CDS       T09424                                  Name (RefSeq) RING-box protein 1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism oke  Oncorhynchus keta (chum salmon) Pathway oke03420   Nucleotide excision repair oke04110   Cell cycle oke04114   Oocyte meiosis oke04120   Ubiquitin mediated proteolysis oke04141   Protein processing in endoplasmic reticulum oke04310   Wnt signaling pathway oke04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:oke00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     118365448    04120 Ubiquitin mediated proteolysis     118365448   09124 Replication and repair    03420 Nucleotide excision repair     118365448  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     118365448    04350 TGF-beta signaling pathway     118365448  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     118365448    04114 Oocyte meiosis     118365448  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:oke04121]     118365448    03400 DNA repair and recombination proteins [BR:oke03400]     118365448 Enzymes [BR:oke01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      118365448 Ubiquitin system [BR:oke04121]  Ubiquitin ligases (E3)   UBL E3 ligases    118365448   Multi subunit type E3    SCF complex     Ring finger protein      118365448    Cul2 complex      118365448    Cul3 complex      118365448    Cul4 complex      118365448    Cul7 complex      118365448    Cul8 complex      118365448    Cul9 complex      118365448 DNA repair and recombination proteins [BR:oke03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       118365448     TCR (transcription coupled repair) factors      Cul4-CSA complex       118365448 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  118365448 NCBI-ProteinID:  XP_035603566 LinkDB All DBs Position 32:complement(26525465..26529422) Genome browser AA seq 108 aa AA seqDB search MAAAMDVDTPSATNSGASKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcggcagcgatggatgttgataccccaagcgccacgaatagtggagcaagcaagaaa cgttttgaagtgaagaagtggaatgcagtggcactttgggcctgggacattgtggtggac aactgtgccatctgtaggaatcacattatggatctctgcatagagtgccaggctaaccag gcctctgccacatcagaggagtgcaccgtagcttggggagtctgcaatcatgcattccat ttccactgtatctctcgttggttgaagaccaggcaggtgtgccccctagacaacagggag tgggagtttcagaaatatggacactag

DBGET integrated database retrieval system