Oncorhynchus keta (chum salmon): 118379501 Help Entry 118379501         CDS       T09424                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism oke  Oncorhynchus keta (chum salmon) Pathway oke00510   N-Glycan biosynthesis oke00513   Various types of N-glycan biosynthesis oke04141   Protein processing in endoplasmic reticulum Module oke_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:oke00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     118379501    00513 Various types of N-glycan biosynthesis     118379501  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     118379501 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 DUF6512 TctB Phage_holin_3_3 Motif Other DBs NCBI-GeneID:  118379501 NCBI-ProteinID:  XP_052337029 LinkDB All DBs Position 26:44880291..44883736 Genome browser AA seq 79 aa AA seqDB search MELEAMTRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDVFKELLISLVA SLFMGFGVLFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagctggaggccatgaccagatacaccagtccggtgaacccagcagtcttcccccac ctcactgtggtcctcctggctatcggcatgttcttcactgcgtggttctttgtctacgag gtaacatccactaaatacaccagagacgtgttcaaagagctgctcatctccctggtggcg tcgctcttcatgggcttcggagtgctgtttctgttactgtgggtcggcatctatgtctga

DBGET integrated database retrieval system