Oncorhynchus keta (chum salmon): 118396016 Help Entry 118396016         CDS       T09424                                  Symbol tmem258 Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism oke  Oncorhynchus keta (chum salmon) Pathway oke00510   N-Glycan biosynthesis oke00513   Various types of N-glycan biosynthesis oke04141   Protein processing in endoplasmic reticulum Module oke_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:oke00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     118396016 (tmem258)    00513 Various types of N-glycan biosynthesis     118396016 (tmem258)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     118396016 (tmem258) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 DUF6512 TctB Phage_holin_3_3 Motif Other DBs NCBI-GeneID:  118396016 NCBI-ProteinID:  XP_035646054 LinkDB All DBs Position 17:complement(61575628..61578713) Genome browser AA seq 79 aa AA seqDB search MELEAMTRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDVFKELLISLVA SLFMGFGVLFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagctggaggccatgaccagatacaccagtccggtgaacccggcagtcttcccccac ctcactgtggtcctactggctatcggcatgttcttcactgcgtggttctttgtctacgag gtaacgtccactaaatacaccagagacgtgttcaaagagctgctcatctccctggtggcg tctctcttcatgggcttcggagtgctgtttctgttactgtgggtcggcatctatgtctga

DBGET integrated database retrieval system