Oncorhynchus kisutch (coho salmon): 109867326 Help Entry 109867326         CDS       T09179                                  Symbol tmem258 Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism oki  Oncorhynchus kisutch (coho salmon) Pathway oki00510   N-Glycan biosynthesis oki00513   Various types of N-glycan biosynthesis oki04141   Protein processing in endoplasmic reticulum Module oki_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:oki00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     109867326 (tmem258)    00513 Various types of N-glycan biosynthesis     109867326 (tmem258)  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     109867326 (tmem258) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 DUF6512 TctB Phage_holin_3_3 Motif Other DBs NCBI-GeneID:  109867326 NCBI-ProteinID:  XP_020312026 UniProt:  A0A8C7FF17 LinkDB All DBs Position LG22:57089414..57092246 Genome browser AA seq 79 aa AA seqDB search MELEAMTRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDVFKELLISLVA SLFMGFGVLFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagctggaggccatgacgagatacaccagtccggtgaacccggcagtcttcccccac ctcactgtggtcctactggctatcggcatgttcttcactgcgtggttctttgtctacgag gtaacgtccactaaatacaccagagacgtgttcaaagagctgctcatctccctagtggcg tctctcttcatgggcttcggagtgctgtttctgttactgtgggtcggcatctatgtctga

DBGET integrated database retrieval system