Oncorhynchus kisutch (coho salmon): 109883595 Help Entry 109883595         CDS       T09179                                  Name (RefSeq) transmembrane protein 258   KO K26502   transmembrane protein 258 Organism oki  Oncorhynchus kisutch (coho salmon) Pathway oki00510   N-Glycan biosynthesis oki00513   Various types of N-glycan biosynthesis oki04141   Protein processing in endoplasmic reticulum Module oki_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:oki00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     109883595    00513 Various types of N-glycan biosynthesis     109883595  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     109883595 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ost5 DUF6512 TctB Phage_holin_3_3 Motif Other DBs NCBI-GeneID:  109883595 NCBI-ProteinID:  XP_020331214 Ensembl:  ENSOKIG00005011783 UniProt:  A0A8C7FF17 LinkDB All DBs Position LG10:complement(4683265..4686260) Genome browser AA seq 79 aa AA seqDB search MELEAMTRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDVFKELLISLVA SLFMGFGVLFLLLWVGIYV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagctggaggccatgaccagatacaccagtccggtgaacccagcagtcttcccccac ctcactgtggtcctactggctatcggcatgttcttcactgcgtggttctttgtctacgag gtaacgtccactaaatacaccagagacgtgttcaaagagctgctcatctccctggtggcg tcgctcttcatgggcttcggggtgctgtttctgttactgtgggtcggcatctatgtctga

DBGET integrated database retrieval system