Oncorhynchus kisutch (coho salmon): 109898577 Help Entry 109898577         CDS       T09179                                  Name (RefSeq) RING-box protein 1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism oki  Oncorhynchus kisutch (coho salmon) Pathway oki03420   Nucleotide excision repair oki04110   Cell cycle oki04114   Oocyte meiosis oki04120   Ubiquitin mediated proteolysis oki04141   Protein processing in endoplasmic reticulum oki04310   Wnt signaling pathway oki04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:oki00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     109898577    04120 Ubiquitin mediated proteolysis     109898577   09124 Replication and repair    03420 Nucleotide excision repair     109898577  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     109898577    04350 TGF-beta signaling pathway     109898577  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     109898577    04114 Oocyte meiosis     109898577  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:oki04121]     109898577    03400 DNA repair and recombination proteins [BR:oki03400]     109898577 Enzymes [BR:oki01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      109898577 Ubiquitin system [BR:oki04121]  Ubiquitin ligases (E3)   UBL E3 ligases    109898577   Multi subunit type E3    SCF complex     Ring finger protein      109898577    Cul2 complex      109898577    Cul3 complex      109898577    Cul4 complex      109898577    Cul7 complex      109898577    Cul8 complex      109898577    Cul9 complex      109898577 DNA repair and recombination proteins [BR:oki03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       109898577     TCR (transcription coupled repair) factors      Cul4-CSA complex       109898577 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 Arif-1 DUF8003 PHD_NSD Motif Other DBs NCBI-GeneID:  109898577 NCBI-ProteinID:  XP_020349185 Ensembl:  ENSOKIG00005007592 UniProt:  A0A8C7D775 LinkDB All DBs Position LG6:complement(75503313..75506328) Genome browser AA seq 108 aa AA seqDB search MAAAMDVDTPSATNSGASKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcggcagcgatggatgttgataccccaagcgccacgaatagtggagcgagcaagaaa cgttttgaagtgaagaagtggaatgcagtggcactttgggcctgggacattgtggtggac aactgtgccatctgtaggaatcacattatggatctctgcatagagtgccaggctaaccag gcctctgccacatcagaggagtgcaccgtagcctggggagtctgcaatcatgcattccat ttccactgtatctcccgttggttgaagaccaggcaggtgtgccccctagacaacagggag tgggagtttcagaaatatggacactag

DBGET integrated database retrieval system