Oncorhynchus kisutch (coho salmon): 116360631 Help Entry 116360631         CDS       T09179                                  Name (RefSeq) ras-related protein Rap-1b-like   KO K07836   Ras-related protein Rap-1B Organism oki  Oncorhynchus kisutch (coho salmon) Pathway oki04010   MAPK signaling pathway oki04510   Focal adhesion oki04520   Adherens junction Brite KEGG Orthology (KO) [BR:oki00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     116360631  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     116360631    04520 Adherens junction     116360631  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oki04147]     116360631    04031 GTP-binding proteins [BR:oki04031]     116360631 Exosome [BR:oki04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    116360631   Exosomal proteins of other body fluids (saliva and urine)    116360631   Exosomal proteins of colorectal cancer cells    116360631 GTP-binding proteins [BR:oki04031]  Small (monomeric) G-proteins   Ras Family    Rap [OT]     116360631 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf Motif Other DBs NCBI-GeneID:  116360631 NCBI-ProteinID:  XP_031671505 LinkDB All DBs Position Unknown AA seq 108 aa AA seqDB search MLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPM ILVGNKCDLEDERVVGKEQGAEPGQTVEQLCFPGVLRKVQDQRQRDLL NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atgctggaaattctggacactgcagggacggaacaattcacagccatgagagatctgtac atgaagaatggccagggctttgcgttagtgtactccatcacagcccagtccaccttcaac gatctgcaagacctacgagagcagatcctcagagtcaaagacactgacgatgttccgatg attctggtgggtaataaatgtgatctggaggatgagcgtgttgtggggaaggaacagggg gcagaacctggccagacagtggagcagctgtgctttcctggagtcctccgcaaagtccaa gatcaacgtcaacgagatcttctatga

DBGET integrated database retrieval system