Oryzias latipes (Japanese medaka): 101156259 Help Entry 101156259         CDS       T02443                                  Symbol ran Name (RefSeq) GTP-binding nuclear protein Ran   KO K07936   GTP-binding nuclear protein Ran Organism ola  Oryzias latipes (Japanese medaka) Pathway ola03008   Ribosome biogenesis in eukaryotes ola03013   Nucleocytoplasmic transport ola03250   Viral life cycle - HIV-1 Brite KEGG Orthology (KO) [BR:ola00001]  09120 Genetic Information Processing   09122 Translation    03013 Nucleocytoplasmic transport     101156259 (ran)    03008 Ribosome biogenesis in eukaryotes     101156259 (ran)   09125 Information processing in viruses    03250 Viral life cycle - HIV-1     101156259 (ran)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:ola03019]     101156259 (ran)    03009 Ribosome biogenesis [BR:ola03009]     101156259 (ran)    03016 Transfer RNA biogenesis [BR:ola03016]     101156259 (ran)    03036 Chromosome and associated proteins [BR:ola03036]     101156259 (ran)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ola04147]     101156259 (ran)    04031 GTP-binding proteins [BR:ola04031]     101156259 (ran) Messenger RNA biogenesis [BR:ola03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     Ran-mediated transport factors      101156259 (ran) Ribosome biogenesis [BR:ola03009]  Eukaryotic type   Pre-40S particles    Export and cytoplasmic maturation factors     101156259 (ran)   Pre-60S particles     101156259 (ran) Transfer RNA biogenesis [BR:ola03016]  Eukaryotic type   tRNA transport factors    tRNA export factors     101156259 (ran) Chromosome and associated proteins [BR:ola03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Regulators of centriole replication      101156259 (ran)    Spindle formation proteins     101156259 (ran) Exosome [BR:ola04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    101156259 (ran) GTP-binding proteins [BR:ola04031]  Small (monomeric) G-proteins   Ran Family    Ran     101156259 (ran) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 Gtr1_RagA RNA_helicase ArgoMid AAA_24 Pox_A32 TsaE AAA_7 DUF5906 Motif Other DBs NCBI-GeneID:  101156259 NCBI-ProteinID:  XP_004073279 UniProt:  A0A3P9JMZ6 H2LEC1 LinkDB All DBs Position 10:complement(13953779..13956510) Genome browser AA seq 219 aa AA seqDB search MADSMGQSVPVAVFKLVLVGDGGTGKTTFVKRHITGEFEKKYVATLGVEVHPLMFHTNRG PIKYNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPI VLCGNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFV AMPALAPPEVLMDPNLAAKYEEELQVASQTALPDEEDDL NT seq 660 nt NT seq  +upstreamnt  +downstreamnt atggctgattcaatggggcagtctgtaccagttgcagttttcaagttggtgctggttgga gatggaggcacaggaaaaacgacttttgtgaagagacacattacaggagagtttgagaag aagtatgtagctactctcggagtcgaagtgcacccactgatgttccacaccaacagagga cccatcaagtacaatgtctgggacacagctggtcaggagaaatttgggggcctgagagat ggctactatattcaagctcagtgtgctatcatcatgtttgatgtcacatctcgggtcacc tacaaaaacgtacccaactggcaccgtgacttggtccgtgtctgtgagaacattcccatt gtcctttgcggcaacaaggtagacatcaaagacagaaaagtcaaagccaagagcatcgtg tttcaccgcaagaagaacttgcagtactatgacatttctgccaagagtaactacaacttt gagaagcccttcctgtggttagcaaggaagttgatcggtgatccaaatctggagtttgtg gcaatgcctgcccttgctcccccagaggtccttatggaccccaaccttgccgctaaatac gaggaagaacttcaggttgcatcacagacagcactcccagatgaagaagatgacctctaa

DBGET integrated database retrieval system