Oryzias latipes (Japanese medaka): 101170590 Help Entry 101170590         CDS       T02443                                  Symbol rbx1 Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism ola  Oryzias latipes (Japanese medaka) Pathway ola03420   Nucleotide excision repair ola04110   Cell cycle ola04114   Oocyte meiosis ola04120   Ubiquitin mediated proteolysis ola04141   Protein processing in endoplasmic reticulum ola04310   Wnt signaling pathway ola04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:ola00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     101170590 (rbx1)    04120 Ubiquitin mediated proteolysis     101170590 (rbx1)   09124 Replication and repair    03420 Nucleotide excision repair     101170590 (rbx1)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     101170590 (rbx1)    04350 TGF-beta signaling pathway     101170590 (rbx1)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     101170590 (rbx1)    04114 Oocyte meiosis     101170590 (rbx1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:ola04121]     101170590 (rbx1)    03400 DNA repair and recombination proteins [BR:ola03400]     101170590 (rbx1) Enzymes [BR:ola01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      101170590 (rbx1) Ubiquitin system [BR:ola04121]  Ubiquitin ligases (E3)   UBL E3 ligases    101170590 (rbx1)   Multi subunit type E3    SCF complex     Ring finger protein      101170590 (rbx1)    Cul2 complex      101170590 (rbx1)    Cul3 complex      101170590 (rbx1)    Cul4 complex      101170590 (rbx1)    Cul7 complex      101170590 (rbx1)    Cul8 complex      101170590 (rbx1)    Cul9 complex      101170590 (rbx1) DNA repair and recombination proteins [BR:ola03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       101170590 (rbx1)     TCR (transcription coupled repair) factors      Cul4-CSA complex       101170590 (rbx1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 zf-RING_16 Motif Other DBs NCBI-GeneID:  101170590 NCBI-ProteinID:  XP_004071822 UniProt:  A0A3P9IE58 LinkDB All DBs Position 8:complement(19409624..19411753) Genome browser AA seq 108 aa AA seqDB search MAAAMDVDTPSGANSGSSKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcagcagcgatggacgttgacacaccgagtggtgctaacagtggctcaagcaagaaa cgcttcgaagttaaaaagtggaatgctgtggcgctgtgggcctgggacattgttgtggat aactgcgccatctgtagaaaccacatcatggatctctgcatagaatgtcaagccaaccaa gcatctgcaacctcagaggaatgcacagtagcctggggggtctgcaatcatgcattccat ttccattgtatttcccgctggttgaaaaccagacaagtgtgtccccttgataacagagag tgggagtttcagaaatatggacattga

DBGET integrated database retrieval system