Onychostoma macrolepis: 131521209 Help Entry 131521209         CDS       T09350                                  Symbol bcl2b Name (RefSeq) apoptosis regulator Bcl-2   KO K02161   apoptosis regulator Bcl-2 Organism omc  Onychostoma macrolepis Pathway omc04115   p53 signaling pathway omc04140   Autophagy - animal omc04141   Protein processing in endoplasmic reticulum omc04210   Apoptosis omc04217   Necroptosis omc04261   Adrenergic signaling in cardiomyocytes omc04340   Hedgehog signaling pathway omc04510   Focal adhesion omc04621   NOD-like receptor signaling pathway omc05132   Salmonella infection omc05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:omc00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     131521209 (bcl2b)  09130 Environmental Information Processing   09132 Signal transduction    04340 Hedgehog signaling pathway     131521209 (bcl2b)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     131521209 (bcl2b)   09143 Cell growth and death    04210 Apoptosis     131521209 (bcl2b)    04217 Necroptosis     131521209 (bcl2b)    04115 p53 signaling pathway     131521209 (bcl2b)   09144 Cellular community - eukaryotes    04510 Focal adhesion     131521209 (bcl2b)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     131521209 (bcl2b)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     131521209 (bcl2b)  09160 Human Diseases   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     131521209 (bcl2b)   09171 Infectious disease: bacterial    05132 Salmonella infection     131521209 (bcl2b)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:omc01009]     131521209 (bcl2b) Protein phosphatases and associated proteins [BR:omc01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      131521209 (bcl2b) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  131521209 NCBI-ProteinID:  XP_058601711 LinkDB All DBs Position 02:5760048..5833067 Genome browser AA seq 207 aa AA seqDB search MAQENVYDNRSIVVKYIHHKLWKKGYVWEVNGHEDSVSNGLMMGRQEDRGGSRHDPFSAL HTVLREAGDELERLYQSDFAEMSKQLHLTSITAHQRFTAVIDELFRDGVNWGRIIAFFEF GGTICVECVNKEMTAQVDNIAGWMTEYLNGPLHGWIQENGGWEAFVELYGRQRDSVFRSS WSSIVTVFGLAALGAVGLTIGAYLAQK NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcacaggagaatgtgtatgataaccgcagtatagtggtgaagtacatccaccataag ctctggaagaagggatacgtgtgggaagtgaacggacacgaagacagtgtctcgaatgga ctgatgatggggagacaggaggaccgcggcggctcccgtcacgacccgttcagcgctctt cacacggtgctacgggaggccggggacgagctggagcggctgtatcagtcggactttgcg gagatgtccaaacagctgcatctcacgtccatcacggcgcatcagcgcttcaccgcggtc attgacgagctgttcagggacggcgtgaactggggcagaatcatcgcttttttcgagttt ggagggaccatttgcgtcgaatgcgtgaataaggagatgactgcgcaggtggataacatc gcgggctggatgaccgagtatctgaacgggccgctgcacggctggatccaggagaacggc ggctgggaggcgtttgtggagctctacggcaggcagagggactctgtgtttcgcagctcg tggtcatcgatagtaacggtctttggtctagccgctctcggggccgttggcttgaccata ggagcctaccttgctcagaaatga

DBGET integrated database retrieval system