Onychostoma macrolepis: 131537527 Help Entry 131537527         CDS       T09350                                  Symbol rbx1 Name (RefSeq) E3 ubiquitin-protein ligase RBX1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism omc  Onychostoma macrolepis Pathway omc03420   Nucleotide excision repair omc04110   Cell cycle omc04114   Oocyte meiosis omc04120   Ubiquitin mediated proteolysis omc04141   Protein processing in endoplasmic reticulum omc04310   Wnt signaling pathway omc04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:omc00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     131537527 (rbx1)    04120 Ubiquitin mediated proteolysis     131537527 (rbx1)   09124 Replication and repair    03420 Nucleotide excision repair     131537527 (rbx1)  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     131537527 (rbx1)    04350 TGF-beta signaling pathway     131537527 (rbx1)  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     131537527 (rbx1)    04114 Oocyte meiosis     131537527 (rbx1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:omc04121]     131537527 (rbx1)    03400 DNA repair and recombination proteins [BR:omc03400]     131537527 (rbx1) Enzymes [BR:omc01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      131537527 (rbx1) Ubiquitin system [BR:omc04121]  Ubiquitin ligases (E3)   UBL E3 ligases    131537527 (rbx1)   Multi subunit type E3    SCF complex     Ring finger protein      131537527 (rbx1)    Cul2 complex      131537527 (rbx1)    Cul3 complex      131537527 (rbx1)    Cul4 complex      131537527 (rbx1)    Cul7 complex      131537527 (rbx1)    Cul8 complex      131537527 (rbx1)    Cul9 complex      131537527 (rbx1) DNA repair and recombination proteins [BR:omc03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       131537527 (rbx1)     TCR (transcription coupled repair) factors      Cul4-CSA complex       131537527 (rbx1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 PHD_NSD Motif Other DBs NCBI-GeneID:  131537527 NCBI-ProteinID:  XP_058627030 LinkDB All DBs Position 03:21810631..21812587 Genome browser AA seq 108 aa AA seqDB search MAAAMDVDTPSGANSGASKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcggccgcgatggatgtagacaccccgagtggagctaacagcggagccagtaaaaag cgttttgaagtgaaaaagtggaatgccgtggctctgtgggcttgggacattgtggtggac aactgtgccatttgcagaaatcacattatggacctctgtatagagtgtcaggccaatcag gcgtcagctacgtcagaggagtgtacagtggcctggggagtctgtaatcatgcatttcat ttccactgcatctctcgctggctgaagaccagacaggtgtgtcctctggacaacagagag tgggagttccagaagtacggtcattag

DBGET integrated database retrieval system