Onychostoma macrolepis: 131553906 Help Entry 131553906         CDS       T09350                                  Symbol ran Name (RefSeq) GTP-binding nuclear protein Ran   KO K07936   GTP-binding nuclear protein Ran Organism omc  Onychostoma macrolepis Pathway omc03008   Ribosome biogenesis in eukaryotes omc03013   Nucleocytoplasmic transport omc03250   Viral life cycle - HIV-1 Brite KEGG Orthology (KO) [BR:omc00001]  09120 Genetic Information Processing   09122 Translation    03013 Nucleocytoplasmic transport     131553906 (ran)    03008 Ribosome biogenesis in eukaryotes     131553906 (ran)   09125 Information processing in viruses    03250 Viral life cycle - HIV-1     131553906 (ran)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:omc03019]     131553906 (ran)    03009 Ribosome biogenesis [BR:omc03009]     131553906 (ran)    03016 Transfer RNA biogenesis [BR:omc03016]     131553906 (ran)    03036 Chromosome and associated proteins [BR:omc03036]     131553906 (ran)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:omc04147]     131553906 (ran)    04031 GTP-binding proteins [BR:omc04031]     131553906 (ran) Messenger RNA biogenesis [BR:omc03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     Ran-mediated transport factors      131553906 (ran) Ribosome biogenesis [BR:omc03009]  Eukaryotic type   Pre-40S particles    Export and cytoplasmic maturation factors     131553906 (ran)   Pre-60S particles     131553906 (ran) Transfer RNA biogenesis [BR:omc03016]  Eukaryotic type   tRNA transport factors    tRNA export factors     131553906 (ran) Chromosome and associated proteins [BR:omc03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Regulators of centriole replication      131553906 (ran)    Spindle formation proteins     131553906 (ran) Exosome [BR:omc04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    131553906 (ran) GTP-binding proteins [BR:omc04031]  Small (monomeric) G-proteins   Ran Family    Ran     131553906 (ran) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RNA_helicase G-alpha AAA_24 Gtr1_RagA Pox_A32 ArgoMid AAA_7 Septin TsaE AAA_16 AAA_22 DUF5906 SRPRB Motif Other DBs NCBI-GeneID:  131553906 NCBI-ProteinID:  XP_058654871 LinkDB All DBs Position 14:24834466..24838111 Genome browser AA seq 216 aa AA seqDB search MAETCEPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGAIK YNVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLC GNKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVEMP ALAPPEIAMDPSLAAQYEHDLKVASETALPDEDDDL NT seq 651 nt NT seq  +upstreamnt  +downstreamnt atggcagaaacttgtgagccacaagttcagttcaagctggttctggtaggagatggaggt acggggaaaaccacctttgtgaagagacacttgactggggagttcgaaaagaaatatgtt gccacacttggagttgaggtacatcccctggtcttccacactaacagaggagccatcaaa tataacgtatgggacacagccggacaagagaagttcggaggcctgagagatggatattat atccaggctcagtgtgcaatcatcatgtttgatgtaacttctcgagtgacctataaaaat gtgcccaactggcatcgtgacttggtgcgtgtgtgcgagaacattcccatagtgctgtgc ggtaacaaagtggacatcaaggacaggaaggtcaaagcaaagagcattgtgttccatcgt aagaagaatctacagtactatgacatctctgccaagagtaattataactttgagaagccc ttcctgtggctcgcacggaagctgattggcgaccctaatctggagtttgttgagatgcct gcccttgcaccaccggaaattgccatggatccatcacttgctgcacagtatgagcacgac ttgaaagtggcatcagaaacagctctcccagatgaagatgacgacctttaa

DBGET integrated database retrieval system