Oncorhynchus mykiss (rainbow trout): 110485539 Help Entry 110485539         CDS       T07259                                  Name (RefSeq) stromal cell-derived factor 1   KO K10031   C-X-C motif chemokine 12 Organism omy  Oncorhynchus mykiss (rainbow trout) Pathway omy04060   Cytokine-cytokine receptor interaction omy04672   Intestinal immune network for IgA production omy04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:omy00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     110485539  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     110485539  09150 Organismal Systems   09151 Immune system    04672 Intestinal immune network for IgA production     110485539  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:omy04052]     110485539    00536 Glycosaminoglycan binding proteins [BR:omy00536]     110485539 Cytokines and neuropeptides [BR:omy04052]  Cytokines   Chemokines    110485539 Glycosaminoglycan binding proteins [BR:omy00536]  Heparan sulfate / Heparin   Chemokines    110485539 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  110485539 NCBI-ProteinID:  XP_036796102 Ensembl:  ENSOMYG00000036277 UniProt:  A0A8K9XXF9 LinkDB All DBs Position 13:complement(11797902..11811263) Genome browser AA seq 99 aa AA seqDB search MDVKVLAVLALLAVAMDVPPSTAKPISLVERCWCRSTLNTVPQRSIRELKFLHTPNCPFQ VIAKLKNNREVCINPETKWLQTYLKNAINKVKKSRRRAQ NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atggatgtcaaagtactggctgtgttggccctactggctgtggccatggatgtacctccc tctacggctaagcccatcagcctggtagagaggtgctggtgtcgctccactctgaacacc gtccctcagaggagcatcagagagctcaagttccttcacacacccaactgccctttccaa gtcattgccaagctgaagaacaacagggaggtgtgcattaaccccgagaccaaatggctg cagacgtacctgaagaatgccattaacaaggtgaagaagtccagaagacgtgctcagtaa

DBGET integrated database retrieval system