Oncorhynchus mykiss (rainbow trout): 110486413 Help Entry 110486413         CDS       T07259                                  Name (RefSeq) RING-box protein 1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism omy  Oncorhynchus mykiss (rainbow trout) Pathway omy03420   Nucleotide excision repair omy04110   Cell cycle omy04114   Oocyte meiosis omy04120   Ubiquitin mediated proteolysis omy04141   Protein processing in endoplasmic reticulum omy04310   Wnt signaling pathway omy04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:omy00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     110486413    04120 Ubiquitin mediated proteolysis     110486413   09124 Replication and repair    03420 Nucleotide excision repair     110486413  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     110486413    04350 TGF-beta signaling pathway     110486413  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     110486413    04114 Oocyte meiosis     110486413  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:omy04121]     110486413    03400 DNA repair and recombination proteins [BR:omy03400]     110486413 Enzymes [BR:omy01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      110486413 Ubiquitin system [BR:omy04121]  Ubiquitin ligases (E3)   UBL E3 ligases    110486413   Multi subunit type E3    SCF complex     Ring finger protein      110486413    Cul2 complex      110486413    Cul3 complex      110486413    Cul4 complex      110486413    Cul7 complex      110486413    Cul8 complex      110486413    Cul9 complex      110486413 DNA repair and recombination proteins [BR:omy03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       110486413     TCR (transcription coupled repair) factors      Cul4-CSA complex       110486413 SSDB OrthologParalogGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 DUF8003 Motif Other DBs NCBI-GeneID:  110486413 NCBI-ProteinID:  XP_021413681 LinkDB All DBs Position 13:complement(42453094..42456995) Genome browser AA seq 108 aa AA seqDB search MAAAMDVDTPSATNSGASKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcggcagcgatggatgttgataccccaagcgccacgaatagtggagcaagcaagaaa cgttttgaagtgaagaagtggaatgcagtggcactttgggcctgggacattgtcgtggac aactgtgccatctgtaggaatcacattatggatctctgcatagagtgccaggctaaccag gcctctgccacatcagaggagtgcaccgtagcctggggagtctgcaatcatgcattccat ttccactgtatctctcgttggttgaagaccaggcaggtgtgccccctagacaacagggag tgggagtttcagaaatatggacactag

DBGET integrated database retrieval system