Oncorhynchus mykiss (rainbow trout): 110488823 Help Entry 110488823         CDS       T07259                                  Symbol ran Name (RefSeq) GTP-binding nuclear protein Ran   KO K07936   GTP-binding nuclear protein Ran Organism omy  Oncorhynchus mykiss (rainbow trout) Pathway omy03008   Ribosome biogenesis in eukaryotes omy03013   Nucleocytoplasmic transport omy03250   Viral life cycle - HIV-1 Brite KEGG Orthology (KO) [BR:omy00001]  09120 Genetic Information Processing   09122 Translation    03013 Nucleocytoplasmic transport     110488823 (ran)    03008 Ribosome biogenesis in eukaryotes     110488823 (ran)   09125 Information processing in viruses    03250 Viral life cycle - HIV-1     110488823 (ran)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:omy03019]     110488823 (ran)    03009 Ribosome biogenesis [BR:omy03009]     110488823 (ran)    03016 Transfer RNA biogenesis [BR:omy03016]     110488823 (ran)    03036 Chromosome and associated proteins [BR:omy03036]     110488823 (ran)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:omy04147]     110488823 (ran)    04031 GTP-binding proteins [BR:omy04031]     110488823 (ran) Messenger RNA biogenesis [BR:omy03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     Ran-mediated transport factors      110488823 (ran) Ribosome biogenesis [BR:omy03009]  Eukaryotic type   Pre-40S particles    Export and cytoplasmic maturation factors     110488823 (ran)   Pre-60S particles     110488823 (ran) Transfer RNA biogenesis [BR:omy03016]  Eukaryotic type   tRNA transport factors    tRNA export factors     110488823 (ran) Chromosome and associated proteins [BR:omy03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Regulators of centriole replication      110488823 (ran)    Spindle formation proteins     110488823 (ran) Exosome [BR:omy04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    110488823 (ran) GTP-binding proteins [BR:omy04031]  Small (monomeric) G-proteins   Ran Family    Ran     110488823 (ran) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RNA_helicase AAA_24 G-alpha Gtr1_RagA Pox_A32 ArgoMid AAA_7 Septin AAA_16 AAA_22 TsaE DUF5906 SRPRB AAA_33 Motif Other DBs NCBI-GeneID:  110488823 NCBI-ProteinID:  XP_021416917 Ensembl:  ENSOMYG00000033348 LinkDB All DBs Position 14:complement(12919196..12923820) Genome browser AA seq 215 aa AA seqDB search MAEGEPQVQFKLVLVGDGGTGKTTFVKRHLTGEFEKKYVATLGVEVHPLVFHTNRGAIKY NVWDTAGQEKFGGLRDGYYIQAQCAIIMFDVTSRVTYKNVPNWHRDLVRVCENIPIVLCG NKVDIKDRKVKAKSIVFHRKKNLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPA LAPPEILMDPSLAAQYEHDLKVASETALPDEDDDL NT seq 648 nt NT seq  +upstreamnt  +downstreamnt atggcagaaggcgagccacaggtccagttcaagcttgtgttggttggcgatggaggaacg ggaaagactactttcgtcaaaagacatttgacgggagagtttgagaagaaatatgttgcc actctgggagtggaggtgcacccgctggtcttccacactaacagaggggccatcaaatac aacgtgtgggacacagccgggcaggagaagtttggagggctccgagacggctactacatc caagcccagtgtgcgatcatcatgtttgatgtcacgtctcgagtcacctacaagaacgta cccaactggcatcgtgacctggtgcgtgtctgtgagaacattcccatagtcctctgcggc aacaaggtggacatcaaagaccgtaaagtcaaagccaagagcatcgtattccatcgcaag aagaacctccagtactatgacatctctgctaagagtaattacaactttgagaagcccttc ctgtggctagcacggaagctgattggagaccccaacctggagtttgtggccatgcccgcc ctcgcccccccagagatcctcatggacccctccctcgctgcgcagtacgagcacgacctc aaagttgcatcagaaacagcgctcccagatgaagatgatgacctttaa

DBGET integrated database retrieval system