Oncorhynchus nerka (sockeye salmon): 115104268 Help Entry 115104268         CDS       T07952                                  Name (RefSeq) RING-box protein 1   KO K03868   E3 ubiquitin-protein ligase RBX1 [EC:2.3.2.32] Organism one  Oncorhynchus nerka (sockeye salmon) Pathway one03420   Nucleotide excision repair one04110   Cell cycle one04114   Oocyte meiosis one04120   Ubiquitin mediated proteolysis one04141   Protein processing in endoplasmic reticulum one04310   Wnt signaling pathway one04350   TGF-beta signaling pathway Brite KEGG Orthology (KO) [BR:one00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     115104268    04120 Ubiquitin mediated proteolysis     115104268   09124 Replication and repair    03420 Nucleotide excision repair     115104268  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     115104268    04350 TGF-beta signaling pathway     115104268  09140 Cellular Processes   09143 Cell growth and death    04110 Cell cycle     115104268    04114 Oocyte meiosis     115104268  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:one04121]     115104268    03400 DNA repair and recombination proteins [BR:one03400]     115104268 Enzymes [BR:one01000]  2. Transferases   2.3  Acyltransferases    2.3.2  Aminoacyltransferases     2.3.2.32  cullin-RING-type E3 NEDD8 transferase      115104268 Ubiquitin system [BR:one04121]  Ubiquitin ligases (E3)   UBL E3 ligases    115104268   Multi subunit type E3    SCF complex     Ring finger protein      115104268    Cul2 complex      115104268    Cul3 complex      115104268    Cul4 complex      115104268    Cul7 complex      115104268    Cul8 complex      115104268    Cul9 complex      115104268 DNA repair and recombination proteins [BR:one03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     GGR (global genome repair) factors      Cul4-DDB2 complex       115104268     TCR (transcription coupled repair) factors      Cul4-CSA complex       115104268 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  zf-rbx1 zf-ANAPC11 zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_11 Arif-1 DUF8003 PHD_NSD Motif Other DBs NCBI-GeneID:  115104268 NCBI-ProteinID:  XP_029481489 LinkDB All DBs Position LG21:complement(24686976..24690467) Genome browser AA seq 108 aa AA seqDB search MAAAMDVDTPSATNSGASKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQ ASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atggcggcagcgatggatgttgataccccaagcgccacgaatagtggagcaagcaagaaa cgttttgaagtgaagaagtggaatgcagtggcactttgggcctgggacattgtggtggac aactgtgccatctgtaggaatcacattatggatctctgcatagagtgccaggctaaccag gcctctgccacatcagaggagtgcaccgtagcctggggagtctgcaatcatgcattccat ttccactgtatctctcgttggttgaagaccaggcaggtgtgccccctagacaacagggag tgggagtttcagaaatatggacactag

DBGET integrated database retrieval system